Property Summary

NCBI Gene PubMed Count 19
Grant Count 14
R01 Count 11
Funding $1,101,486.46
PubMed Score 99.65
PubTator Score 97.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 0.001
ductal carcinoma in situ 1.100 0.006
invasive ductal carcinoma 1.400 0.013

Gene RIF (6)

PMID Text
26296658 The data indicate that arfaptin 2 is the first molecule to regulate NF-kappaB signaling by interacting with the functional IkappaB kinase complex but not by direct inhibiting IKKbeta phosphorylation.
23695357 The binding of arfaptin1, but not arfaptin2, to PI(4)P is regulated by protein kinase D (PKD) mediated phosphorylation at Ser100 within the AH.
23638170 both Arf1 activation and high membrane curvature are required for efficient recruitment of Arfaptin2 to membranes
22679020 The Arl1.Arfaptin-2 BAR structure suggests that one of the two Arl1 molecules competes with Rac1, which binds to the concave face of the Arfaptin-2 BAR homodimer and may hinder its membrane association.
15809304 arfaptin 2 phosphorylation at Ser260 by Akt inhibits PolyQ-huntingtin-induced toxicity by rescuing proteasome impairment
11854752 arfaptin 2 is involved in regulating huntingtin protein aggregation

AA Sequence

MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRH      1 - 70
PSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKY     71 - 140
ESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI    141 - 210
NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVA    211 - 280
IKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ             281 - 341
//

Text Mined References (26)

PMID Year Title
26296658 2015 Dimer of arfaptin 2 regulates NF-?B signaling by interacting with IKK?/NEMO and inhibiting IKK? kinase activity.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23695357 2013 Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.
23638170 2013 Arf1 and membrane curvature cooperate to recruit Arfaptin2 to liposomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679020 2012 Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...