Property Summary

NCBI Gene PubMed Count 19
PubMed Score 109.53
PubTator Score 97.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 8.8e-04
ductal carcinoma in situ 1745 6.1e-03
invasive ductal carcinoma 2951 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Clubfoot 39 3.114 1.6
Shwachman-Diamond syndrome 17 3.105 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ 1.100 6.1e-03
invasive ductal carcinoma 1.400 1.3e-02
lung cancer 1.300 8.8e-04

Synonym

Accession P53365 B4DX86 B4E306 D3DQT5
Symbols POR1

Gene

PANTHER Protein Class (2)

PDB

1I49   1I4D   1I4L   1I4T   4DCN  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRH      1 - 70
PSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKY     71 - 140
ESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI    141 - 210
NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVA    211 - 280
IKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ             281 - 341
//

Text Mined References (26)

PMID Year Title