Property Summary

NCBI Gene PubMed Count 10
PubMed Score 111.51
PubTator Score 72.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.69440888041602E-7
psoriasis 6685 0.0052217484438857
Disease Target Count Z-score Confidence
Lymphopenia 35 3.837 1.9
Thyroiditis 25 3.052 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.506 0.000
psoriasis -1.400 0.005

Synonym

Accession P52961 Q6NTD2 Q96KT9
Symbols RT6
ART2
ARTC1
CD296

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

 GO Process (1)

Gene RIF (4)

PMID Text
26307000 The altered function and expression of P2X7 and ART1 in the human CD39+ Treg or CD39- Treg cells could participate in the resistance against cell death induced by ATP or NAD.
25292337 This study provides evidence that ARTC1 is activated during the endoplasmic-reticulum stress response, which results in acute ADP-ribosylation of GRP78/BiP paralleling translational inhibition.
17614107 ADPRT Ala762Val polymorphism may play a role in the etiology of squamous cell carcinoma of the head and neck or in linkage disequilibrium with other untyped protective alleles.
16627471 ADP-ribosylation of HNP-1 appears to be primarily an activity of ART1 and occurs in inflammatory conditions and disease

AA Sequence

MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQ      1 - 70
ANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYTANSPLHKEFNAAVREAGR     71 - 140
SRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRGVHGLRFRPAGPRATVRLGGFASASLKHVAA    141 - 210
QQFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYI    211 - 280
KDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAFPDGPGLL                           281 - 327
//

Text Mined References (13)

PMID Year Title
26307000 2016 Evaluation of the expression and function of the P2X7 receptor and ART1 in human regulatory T-cell subsets.
25292337 2015 ARTC1-mediated ADP-ribosylation of GRP78/BiP: a new player in endoplasmic-reticulum stress responses.
21901419 2012 Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17614107 2007 Genetic polymorphisms in DNA base-excision repair genes ADPRT, XRCC1, and APE1 and the risk of squamous cell carcinoma of the head and neck.
16627471 2006 ADP-ribosyltransferase-specific modification of human neutrophil peptide-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11498506 2001 Inactivation of platelet-derived growth factor-BB following modification by ADP-ribosyltransferase.
10092875 1999 Chemotaxin-dependent translocation of immunoreactive ADP-ribosyltransferase-1 to the surface of human neutrophil polymorphs.
More...