Property Summary

NCBI Gene PubMed Count 10
Grant Count 27
R01 Count 14
Funding $3,205,343.38
PubMed Score 111.51
PubTator Score 72.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.506 0.000
psoriasis -1.400 0.005

 GO Process (1)

Gene RIF (4)

PMID Text
26307000 The altered function and expression of P2X7 and ART1 in the human CD39+ Treg or CD39- Treg cells could participate in the resistance against cell death induced by ATP or NAD.
25292337 This study provides evidence that ARTC1 is activated during the endoplasmic-reticulum stress response, which results in acute ADP-ribosylation of GRP78/BiP paralleling translational inhibition.
17614107 ADPRT Ala762Val polymorphism may play a role in the etiology of squamous cell carcinoma of the head and neck or in linkage disequilibrium with other untyped protective alleles.
16627471 ADP-ribosylation of HNP-1 appears to be primarily an activity of ART1 and occurs in inflammatory conditions and disease

AA Sequence

MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQ      1 - 70
ANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYTANSPLHKEFNAAVREAGR     71 - 140
SRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRGVHGLRFRPAGPRATVRLGGFASASLKHVAA    141 - 210
QQFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYI    211 - 280
KDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAFPDGPGLL                           281 - 327
//

Text Mined References (13)

PMID Year Title
26307000 2016 Evaluation of the expression and function of the P2X7 receptor and ART1 in human regulatory T-cell subsets.
25292337 2015 ARTC1-mediated ADP-ribosylation of GRP78/BiP: a new player in endoplasmic-reticulum stress responses.
21901419 2012 Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17614107 2007 Genetic polymorphisms in DNA base-excision repair genes ADPRT, XRCC1, and APE1 and the risk of squamous cell carcinoma of the head and neck.
16627471 2006 ADP-ribosyltransferase-specific modification of human neutrophil peptide-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11498506 2001 Inactivation of platelet-derived growth factor-BB following modification by ADP-ribosyltransferase.
10092875 1999 Chemotaxin-dependent translocation of immunoreactive ADP-ribosyltransferase-1 to the surface of human neutrophil polymorphs.
More...