Property Summary

NCBI Gene PubMed Count 17
Grant Count 263
R01 Count 138
Funding $31,264,646.89
PubMed Score 445.82
PubTator Score 25.69

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P52954 B9EGA2 Q05BB2
Symbols HPX6
HPX-6
LBX1H
homeobox

Gene

Gene RIF (10)

PMID Text
26820155 In embryos overexpressing lbx1b, wnt5b, a ligand of the non-canonical Wnt/planar cell polarity (PCP) pathway, was significantly downregulated.
25987191 LBX1 is a susceptibility gene for idiopathic scoliosis in a Scandinavian population.
25675428 Our results identify two clinically relevant haplotypes in the LBX1-region with opposite effects on AIS risk.
24878781 Based on meta-analysis rs11190870 near LBX1 is likely a susceptibility variant for adolescent idiopathic scoliosis in East Asians.
24721834 Performed a meta-analysis of the LBX1 locus in six Asian and three non-Asian cohorts of adolescent idiopathic scoliosis (AIS) and found significant evidence for association of this locus with AIS susceptibility in all nine cohorts.
23308168 This study shows that the genetic variants near the LBX1 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese Han population.
23096252 The SNP rs11190870 near LBX1 is associated with both susceptibility and curve progression of adolescent idiopathic scoliosis in Han Chinese adolescents.
22301463 Single nucleotide polymorphism near LBX1 is significantly associated with adolescent idiopathic scoliosis in southern Chinese.
22019779 A genome-wide association study identifies common variants near LBX1 associated with adolescent idiopathic scoliosis
19651985 Ladybird homeobox 1 (LBX1), a developmentally regulated homeobox gene, directs expression of the known EMT inducers ZEB1, ZEB2, Snail1, and transforming growth factor beta2 (TGFB2).

AA Sequence

MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG      1 - 70
LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYEL     71 - 140
EKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAE    141 - 210
LEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD    211 - 280
D//

Text Mined References (17)

PMID Year Title
26820155 2016 Functional Investigation of a Non-coding Variant Associated with Adolescent Idiopathic Scoliosis in Zebrafish: Elevated Expression of the Ladybird Homeobox Gene Causes Body Axis Deformation.
25987191 2015 Candidate gene analysis and exome sequencing confirm LBX1 as a susceptibility gene for idiopathic scoliosis.
25675428 2015 Haplotypes at LBX1 have distinct inheritance patterns with opposite effects in adolescent idiopathic scoliosis.
24878781 2014 Association of rs11190870 near LBX1 with adolescent idiopathic scoliosis in East Asians: a systematic review and meta-analysis.
24721834 2014 A meta-analysis identifies adolescent idiopathic scoliosis association with LBX1 locus in multiple ethnic groups.
23308168 2013 Association between common variants near LBX1 and adolescent idiopathic scoliosis replicated in the Chinese Han population.
23096252 2013 Association of rs11190870 near LBX1 with adolescent idiopathic scoliosis susceptibility in a Han Chinese population.
22301463 2012 SNP rs11190870 near LBX1 is associated with adolescent idiopathic scoliosis in southern Chinese.
22019779 2011 A genome-wide association study identifies common variants near LBX1 associated with adolescent idiopathic scoliosis.
19651985 2009 A developmentally regulated inducer of EMT, LBX1, contributes to breast cancer progression.
More...