Property Summary

NCBI Gene PubMed Count 18
PubMed Score 460.03
PubTator Score 25.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (11)

AA Sequence

MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG      1 - 70
LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYEL     71 - 140
EKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAE    141 - 210
LEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD    211 - 280
D//

Text Mined References (18)

PMID Year Title