Property Summary

NCBI Gene PubMed Count 13
PubMed Score 59.91
PubTator Score 17.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Disease Target Count P-value
cystic fibrosis 1696 9.9e-07
Disease Target Count Z-score Confidence
CHARGE syndrome 26 3.67 1.8
Velocardiofacial syndrome 46 3.64 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis -2.768 9.9e-07

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPALPQAAL      1 - 70
QPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDK     71 - 140
AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSD    141 - 210
DNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQI    211 - 280
AHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP      281 - 348
//

Text Mined References (14)

PMID Year Title