Property Summary

NCBI Gene PubMed Count 13
Grant Count 46
R01 Count 19
Funding $2,608,734.61
PubMed Score 57.14
PubTator Score 17.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
20237496 Observational study of gene-disease association. (HuGE Navigator)
17060451 Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors
15931389 Altered expression is associated with therapy failure and death in patients with multiple types of cancer.
8838315 The accession number for the cDNA listed for the sequence data at the bottom of page 335 on the left side is incorrect. It should read U31468 instead of U31458.

AA Sequence

MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPALPQAAL      1 - 70
QPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDK     71 - 140
AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSD    141 - 210
DNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQI    211 - 280
AHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP      281 - 348
//

Text Mined References (14)

PMID Year Title
26412852 2015 Comprehensive comparative homeobox gene annotation in human and mouse.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17060451 2007 Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10690529 2000 Enhanced GBX2 expression stimulates growth of human prostate cancer cells via transcriptional up-regulation of the interleukin 6 gene.
More...