Property Summary

NCBI Gene PubMed Count 21
PubMed Score 50.14
PubTator Score 31.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 4.64880606010637E-7
medulloblastoma, large-cell 6234 8.86905044416866E-6
adult high grade glioma 2148 2.13801879095491E-5
atypical teratoid / rhabdoid tumor 4369 1.78338190173921E-4
Pick disease 1893 5.64037127384196E-4
pilocytic astrocytoma 3086 0.00136815756648805
acute myeloid leukemia 785 0.00400619930652811
nephrosclerosis 329 0.00451842104449656
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00859209753532114
glioblastoma 5572 0.00970754688895564
aldosterone-producing adenoma 664 0.014282599921997
primitive neuroectodermal tumor 3031 0.0196775876591307
progressive supranuclear palsy 674 0.0226589712315097
osteosarcoma 7933 0.0257081259093058

Expression

  Differential Expression (14)

Synonym

Accession P52758 Q6FHU9 Q6IBG0
Symbols PSP
P14.5
UK114
HRSP12

Gene

PDB

1ONI  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
16198412 analysis of ligand binding sites of protein p14.5
14997576 x-ray crystallography study of p14.5

AA Sequence

MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG      1 - 70
CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL        71 - 137
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
22094463 2012 Conserved YjgF protein family deaminates reactive enamine/imine intermediates of pyridoxal 5'-phosphate (PLP)-dependent enzyme reactions.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20817725 2010 Members of the YjgF/YER057c/UK114 family of proteins inhibit phosphoribosylamine synthesis in vitro.
More...