Property Summary

NCBI Gene PubMed Count 44
PubMed Score 57.99
PubTator Score 124.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -2.700 3.6e-04
astrocytic glioma -1.300 3.4e-02
Astrocytoma, Pilocytic -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.600 5.2e-04
Breast cancer 1.200 9.4e-03
chronic rhinosinusitis -1.251 8.7e-03
cystic fibrosis and chronic rhinosinusit... -1.170 1.3e-02
ependymoma -1.400 1.7e-04
esophageal adenocarcinoma 1.200 3.6e-02
glioblastoma -1.300 6.6e-04
group 4 medulloblastoma 2.200 1.9e-03
lung cancer 1.900 1.1e-03
lung carcinoma 3.100 3.5e-43
medulloblastoma, large-cell 1.400 2.7e-02
non-small cell lung cancer -1.210 3.3e-09
oligodendroglioma -1.500 7.3e-09
osteosarcoma 1.815 6.6e-03
ovarian cancer -3.300 1.8e-10
pancreatic cancer -1.200 8.2e-03
pancreatic ductal adenocarcinoma liver m... -1.031 9.3e-04
pituitary cancer -1.200 7.4e-03
subependymal giant cell astrocytoma -2.120 2.7e-03
ulcerative colitis -1.500 3.8e-05

Gene RIF (23)

AA Sequence

MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQAD      1 - 70
ELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKA     71 - 140
AEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFN    141 - 210
YEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLT    211 - 280
TLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITG    281 - 350
ALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN    351 - 420
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF                          421 - 468
//

Text Mined References (44)

PMID Year Title