Property Summary

NCBI Gene PubMed Count 42
PubMed Score 56.52
PubTator Score 124.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P52757 A4D1A2 B3VCF1 B3VCF2 B3VCF3 B3VCF7 B3VCG1 C9J7B0 E9PGE0 F8QPL9 Q2M203 Q75MM2
Symbols BCH
CHN2-3
ARHGAP3
RHOGAP3

Gene

PANTHER Protein Class (2)

PDB

1XA6  

Gene RIF (21)

PMID Text
26315110 CHN2 is consistently hypermethylated and downregulated in small bowel adenocarcinoma with diagnostic potential
25057852 CHN2, ABCB1 and PPP1R9A expression on chromosome 7 is implicated in the pathogenesis of hepatosplenic T-cell lymphoma distinguishing it from other malignancies.
24854763 genetic association studies in a population in Taiwan: Data suggest that an SNP in CHN2 (rs1002630) is associated with non-proliferative diabetic retinopathy in patients with diabetes type 2 in the Han Chinese population studied.
23941981 A significant association of the novel rs186911567 polymorphism was found for the CHN2 gene with smoking.
21911749 genetic association studies in a Chinese population with type 2 diabetes: An SNP in CHN2 (rs39059) is associated with diabetic retinopathy in a Chinese population of type 2 diabetic patients.
20818722 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335173 the Rac-GAP beta2-chimaerin is negatively regulated by protein kinase Cdelta-mediated phosphorylation
More...

AA Sequence

MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQAD      1 - 70
ELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKA     71 - 140
AEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFN    141 - 210
YEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLT    211 - 280
TLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITG    281 - 350
ALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN    351 - 420
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF                          421 - 468
//

Text Mined References (42)

PMID Year Title
26315110 2015 Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility.
25057852 2014 Integrative genomic and transcriptomic analysis identified candidate genes implicated in the pathogenesis of hepatosplenic T-cell lymphoma.
24854763 Chimerin 2 genetic polymorphisms are associated with non-proliferative diabetic retinopathy in Taiwanese type 2 diabetic patients.
24132900 2013 Genome-wide association study of atypical psychosis.
23941981 2013 Association of a novel polymorphism of the ?2-chimaerin gene (CHN2) with smoking.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21911749 2011 CPVL/CHN2 genetic variant is associated with diabetic retinopathy in Chinese type 2 diabetic patients.
20818722 2010 A Bayesian approach to genetic association studies with family-based designs.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
More...