Property Summary

NCBI Gene PubMed Count 43
Grant Count 21
R01 Count 15
Funding $2,205,784.28
PubMed Score 21.45
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 0.018
acute quadriplegic myopathy 1.151 0.000
non-small cell lung cancer 1.483 0.000
lung cancer 1.200 0.006
breast carcinoma 1.100 0.021
group 3 medulloblastoma 1.100 0.001
lung adenocarcinoma 1.100 0.000
inflammatory breast cancer 1.300 0.001
ovarian cancer 2.400 0.000

Gene RIF (7)

PMID Text
26382858 NCBP2 is not required for cell viability and poly(A) RNA export.
21326824 A novel alternative splice variant of CBP20, termed CBP20S, has an in-frame deletion, leading to the translation of a protein lacking most of the RNA recognition motif (RRM).
19668212 determined how importin-beta binds to the cap-binding complex (CBC) through its CBP20 subunit
19648179 a new MIF4G domain-containing protein, CTIF (CBP80/20-dependent translation initiation factor) that interacts directly with CBP80 and is part of the CBP80/20-dependent translation initiation complex
17499042 We show that NELF interacts with the nuclear cap binding complex (CBC), a heterodimeric, multifunctional factor that plays important roles in several mRNA processing steps, and the two factors together participate in the 3' end processing of histone mRNAs
12434151 Structural basis of m7GpppG binding to the nuclear cap-binding protein complex.
12374755 crystal structure at 2.1 A resolution of CBP20 and CBP80 bound to an m(7)GpppG cap analogue

AA Sequence

MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII      1 - 70
MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQ     71 - 140
DYDAGRGGYGKLAQNQ                                                          141 - 156
//

Text Mined References (53)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21326824 Binding properties and dynamic localization of an alternative isoform of the cap-binding complex subunit CBP20.
More...