Property Summary

NCBI Gene PubMed Count 44
PubMed Score 24.22
PubTator Score 25.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.151 3.3e-06
astrocytoma 1.100 1.8e-02
Breast cancer 1.200 4.2e-12
breast carcinoma 1.100 2.1e-02
group 3 medulloblastoma 1.100 7.1e-04
lung adenocarcinoma 1.100 4.0e-08
lung cancer 1.200 5.5e-03
non-small cell lung cancer 1.483 1.4e-19
ovarian cancer 1.500 1.2e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII      1 - 70
MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQ     71 - 140
DYDAGRGGYGKLAQNQ                                                          141 - 156
//

Text Mined References (54)

PMID Year Title