Property Summary

NCBI Gene PubMed Count 4
Grant Count 58
R01 Count 31
Funding $6,214,668.32
PubMed Score 156.30
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P51864
Symbols CR-3
TDGF1
TDGF2
TDGF3
CRIPTO
CRIPTO3
CRIPTO-3

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
18835250 These data indicate that CRIPTO3 is an expressed gene, particularly in certain cancers, and suggest a potentially novel mechanism of oncogenesis through activation of a retrogene.
16954206 CRIPTO-3, a processed pseudogene of CRIPTO-1 on the X chromosome, is expressed in undifferentiated NT2 cells and is regulated by germ cell nuclear factor in parallel to CRIPTO-1

AA Sequence

MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIRPRSSQRVLPM      1 - 70
GIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRC     71 - 140
FPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGICLSIQSYY                          141 - 188
//

Text Mined References (4)

PMID Year Title
18835250 2008 CRIPTO3, a presumed pseudogene, is expressed in cancer.
16954206 2006 Germ cell nuclear factor is a repressor of CRIPTO-1 and CRIPTO-3.
15772651 2005 The DNA sequence of the human X chromosome.
1882841 1991 Isolation and characterization of the CRIPTO autosomal gene and its X-linked related sequence.