Property Summary

NCBI Gene PubMed Count 4
PubMed Score 160.37
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 2.5e-03
Disease Target Count Z-score Confidence
Holoprosencephaly 56 3.771 1.9
Disease Target Count Z-score Confidence
Cancer 2499 4.116 2.1

Synonym

Accession P51864
Symbols CR-3
TDGF1
TDGF2
TDGF3
CRIPTO
CRIPTO3
CRIPTO-3

Gene

PANTHER Protein Class (1)

Gene RIF (2)

AA Sequence

MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIRPRSSQRVLPM      1 - 70
GIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRC     71 - 140
FPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGICLSIQSYY                          141 - 188
//

Text Mined References (4)

PMID Year Title