Property Summary

NCBI Gene PubMed Count 9
Grant Count 17
R01 Count 17
Funding $978,631.71
PubMed Score 7.37
PubTator Score 11.90

Knowledge Summary

Patent (4,275)

Gene RIF (3)

PMID Text
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17868328 Mutants of GC-activating protein 2 modulated ROS-GC2 in a manner different from their action on ROS-GC1 indicating that the Ca2+ sensitivity of the Ca2+ sensor is controlled by the mode of target-sensor interaction.
16941478 Results show GUCY2F gene was implicated in the pathogenesis of breast, lung, and pancreatic cancers and it may be useful targets for diagnostic and therapeutic intervention in selected patients.

AA Sequence

MFLGLGRFSRLVLWFAAFRKLLGHHGLASAKFLWCLCLLSVMSLPQQVWTLPYKIGVVGPWACDSLFSKA      1 - 70
LPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMASGFIGPTNPGYCEAASLLGN     71 - 140
SWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVMKYFQWAHAGVISSDEDIWVHTANRVASALR    141 - 210
SHGLPVGVVLTTGQDSQSMRKALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVP    211 - 280
YDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFG    281 - 350
TIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS    351 - 420
TYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKICHGGIDPAFAMMVCLTLLIALLSINGFAYFI    421 - 490
RRRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRASVSFQITSEVQSGRSPRLSFSSGSLTPATYEN    491 - 560
SNIAIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKDLRHENINPLLGFFYDSGMFAIVTEFCSRGS    561 - 630
LEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRL    631 - 700
SEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPV    701 - 770
YRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR    771 - 840
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLN    841 - 910
DLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIR    911 - 980
IGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELK    981 - 1050
GKGTEETFWLIGKKGFMKPLPVPPPVDKDGQVGHGLQPVEIAAFQRRKAERQLVRNKP               1051 - 1108
//

Text Mined References (12)

PMID Year Title
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
17868328 2007 Expression level and activity profile of membrane bound guanylate cyclase type 2 in rod outer segments.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16941478 2006 Somatic mutations of GUCY2F, EPHA3, and NTRK3 in human cancers.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9698373 1998 The kinase homology domain of retinal guanylyl cyclases 1 and 2 specifies the affinity and cooperativity of interaction with guanylyl cyclase activating protein-2.
9153227 1997 Two eye guanylyl cyclases are expressed in the same photoreceptor cells and form homomers in preference to heteromers.
More...