Property Summary

NCBI Gene PubMed Count 148
Grant Count 154
R01 Count 84
Funding $15,579,887.21
PubMed Score 58.06
PubTator Score 250.18

Knowledge Summary

Patent (40,596)

Expression

Synonym

Accession P51684 E1P5C6 P78553 Q92846 C-C CKR-6
Symbols BN-1
DCR2
DRY6
CCR-6
CD196
CKRL3
GPR29
CKR-L3
CMKBR6
GPRCY4
STRL22
CC-CKR-6
C-C CKR-6

Gene

  TechDev Info (1)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
493098 screening 1656 / 0 / 339273 uHTS identification of small molecule antagonists of the CCR6 receptor via a luminescent beta-arrestin assay
493121 summary 0 / 0 / 0 Summary assay for selective small molecule antagonists of the CCR6 receptor
493159 summary 0 / 0 / 0 Summary assay for small molecule antagonists of the CCR6 receptor
504728 confirmatory 58 / 0 / 225 Dose Response confirmation of small molecule antagonists of the CCR6 receptor: a luminescent beta-arrestin assay
540334 confirmatory 13 / 0 / 6 SAR analysis of small molecule antagonists of the CCR6 receptor: a luminescent beta-arrestin assay
624129 confirmatory 15 / 0 / 595 Dose Response confirmation of uHTS hits from a small molecule antagonists of the CXCR6 receptor in a screening assay
651601 confirmatory 1 / 0 / 5 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay
651708 confirmatory 7 / 0 / 28 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay - 3
651941 confirmatory 0 / 0 / 9 SAR analysis of small molecule antagonists of the CXCR6 receptor using a CCR6 receptor luminescent beta-arrestin counterscreen

Gene RIF (123)

PMID Text
26536229 High CCR6 expression is associated with Inflammatory Bowel Disease.
26345847 Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment
26314374 CCR6 SNPs are a risk factor for presence of anti-topoisomerase I antibodies in systemic sclerosis.
26156805 AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer.
26138531 the current data demonstrate a genetic association between CCR6 variants and susceptibility to lupus nephritis
26125463 Leukocytes expressing CCR6 are present in the ovary immediately prior to ovulation.
25928629 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population
25879557 The data reviewed suggest the necessity of evaluation of other blood redox-balance and nitric oxide in psoriasis should with additional investigations to targeting CCR6 rs3093024 in the genetic susceptibility of psoriasis.
25833398 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25768730 Th17 cells are recruited into tumor tissues preferentially through CCR6-CCL20 pathway
More...

AA Sequence

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVIT      1 - 70
FAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCIS     71 - 140
MDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRW    141 - 210
KLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAAN    211 - 280
LGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAG    281 - 350
RYSENISRQTSETADNDNASSFTM                                                  351 - 374
//

Text Mined References (150)

PMID Year Title
26536229 2015 Expression of CCL20 and Its Corresponding Receptor CCR6 Is Enhanced in Active Inflammatory Bowel Disease, and TLR3 Mediates CCL20 Expression in Colonic Epithelial Cells.
26345847 2015 Regulation of CD4?FOXP3? T cells by CCL20/CCR6 axis in early unexplained recurrent miscarriage patients.
26314374 Confirmation of CCR6 as a risk factor for anti-topoisomerase I antibodies in systemic sclerosis.
26156805 2015 The key role of astrocyte elevated gene-1 in CCR6-induced EMT in cervical cancer.
26138531 2015 Association of variants in CCR6 with susceptibility to lupus nephritis in Chinese.
26125463 2015 Chemokine Ligand 20: A Signal for Leukocyte Recruitment During Human Ovulation?
25928629 2015 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population.
25879557 2015 Evaluation of blood redox-balance, nitric oxide content and CCR6 rs3093024 in the genetic susceptibility during psoriasis.
25833398 2015 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25768730 2015 Preferential recruitment of Th17 cells to cervical cancer via CCR6-CCL20 pathway.
More...