Property Summary

Ligand Count 4
NCBI Gene PubMed Count 163
PubMed Score 63.71
PubTator Score 250.18

Knowledge Summary

Patent (40,596)

Expression

Gene RIF (138)

AA Sequence

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVIT      1 - 70
FAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCIS     71 - 140
MDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRW    141 - 210
KLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAAN    211 - 280
LGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAG    281 - 350
RYSENISRQTSETADNDNASSFTM                                                  351 - 374
//

Text Mined References (165)

PMID Year Title