Property Summary

NCBI Gene PubMed Count 151
Grant Count 234
R01 Count 140
Funding $17,498,298.62
PubMed Score 381.37
PubTator Score 340.47

Knowledge Summary

Patent (70,161)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Synonym

Accession P51677 B3KVQ1 F5GWL6 Q15748 Q2YDB9 Q86WD2 Q8TDP6 Q9ULY8 C-C CKR-3
Symbols CKR3
CD193
CMKBR3
CC-CKR-3

Gene

  TechDev Info (1)

Gene RIF (142)

PMID Text
26756352 Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells.
26409848 Data indicate that approximately 4.5% dispersed osteoarthritis (OA) synovial tissue cells are CC chemokine receptor CCR 3 (CCR3)+ cells.
26289103 This meta-analysis provides robust estimates that interleukin 18 receptor accessory protein rs917997 and chemokine (C-C motif) receptor 3 rs6441961 are potential risk factors for celiac disease in European populations.
25986216 Results highlight the potential role of CCR genes in narcolepsy and support the hypothesis that patients with narcolepsy have impaired immune function.
25450766 Results show the structure of CCL11 bound to the sulfated N-terminal region of its receptor CCR3 and show that intact CCR3 is sulfated and sulfation enhances receptor activity.
24917456 CCL28-CCR3 interactions are involved in the homeostatic trafficking of CD4(+) T cells to the upper airways.
24489825 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
24041034 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
24041034 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
24041034 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
More...

AA Sequence

MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILIKYRRLRIMTN      1 - 70
IYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVF     71 - 140
ALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVL    141 - 210
PLLVMAICYTGIIKTLLRCPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLD    211 - 280
LVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPE    281 - 350
LSIVF                                                                     351 - 355
//

Text Mined References (152)

PMID Year Title
26756352 2016 Periprostatic adipocytes act as a driving force for prostate cancer progression in obesity.
26409848 2016 Upregulated expression of CCR3 in osteoarthritis and CCR3 mediated activation of fibroblast-like synoviocytes.
26289103 2015 Systematic review and meta-analysis of the association between IL18RAP rs917997 and CCR3 rs6441961 polymorphisms with celiac disease risks.
25986216 2015 A polymorphism in CCR1/CCR3 is associated with narcolepsy.
25450766 2014 Structural basis of receptor sulfotyrosine recognition by a CC chemokine: the N-terminal region of CCR3 bound to CCL11/eotaxin-1.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24917456 2015 A role for CCL28-CCR3 in T-cell homing to the human upper airway mucosa.
23955446 2013 Evaluation of CCR3 as a basophil activation marker.
23742077 2013 Retinoic acids up-regulate functional eosinophil-driving receptor CCR3.
More...