Property Summary

NCBI Gene PubMed Count 155
Grant Count 82
R01 Count 54
Funding $7,284,790.31
PubMed Score 794.79
PubTator Score 459.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P51654 C9JLE3 G3V1R0 Q2L880 Q2L882
Symbols SGB
DGSX
MXR7
SDYS
SGBS
OCI-5
SGBS1
GTR2-2

Gene

Gene RIF (132)

PMID Text
26977595 GPC3 expression was measured in hepatocellular carcinoma at different stages and correlated with prognosis. CK19+/GPC3+ HCC has the highest risk of intrahepatic metastasis, microvascular invasion, regional lymph node involvement, and distant metastasis.
26764243 In South Korean hepatocellular carcinoma patients, GPC3 expression was more frequent in hepatocellular carcinoma with aggressive features, but it was not an independent prognostic biomarker.
26722522 Glypican 3 expression showed a significant difference between endometrioid endometrial carcinoma and serous endometrial carcinoma, and it was significantly correlated with tumor grade, stage and myometrial invasion
26517809 Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis.
26502856 In this meta-analysis, GPC3 was found to be acceptable as a serum marker for the diagnosis of hepatocellular carcinoma.
26345955 GPC3 may be a candidate marker for detecting lung squamous cell carcinoma.
26332121 study suggests that GPC3 is involved in HCC cell migration and motility through HS chain-mediated cooperation with the HGF/Met pathway, showing how HS targeting has potential therapeutic implications for liver cancer
26256079 Review: Glypican-3 is a highly specific biomarker for the diagnosis of hepatocellular carcinoma and a promising therapeutic target.
26052074 Identify a GPC3-specific T-cell receptor. Expression of this receptor by T cells allows them to recognize and kill GPC3-positive hepatoma cells.
25967456 Downregulation of glypican-3 expression increases migration, invasion, and tumorigenicity of ovarian cancer.
More...

AA Sequence

MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGP      1 - 70
TCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQ     71 - 140
AFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGN    141 - 210
FPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNV    211 - 280
VMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCA    281 - 350
HSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT    351 - 420
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDE    421 - 490
EGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS    491 - 560
PLKLLTSMAISVVCFFFLVH                                                      561 - 580
//

Text Mined References (154)

PMID Year Title
26977595 2016 CK19 and Glypican 3 Expression Profiling in the Prognostic Indication for Patients with HCC after Surgical Resection.
26764243 2016 Expression profile and prognostic value of glypican-3 in post-operative South Korean hepatocellular carcinoma patients.
26722522 2015 Immunohistochemical expression of glypican 3 in endometrial carcinoma and correlation with prognostic parameters.
26517809 2015 Novel insights into Notum and glypicans regulation in colorectal cancer.
26502856 2015 Diagnosis accuracy of serum Glypican-3 level in patients with hepatocellular carcinoma and liver cirrhosis: a meta-analysis.
26345955 2015 Differential expression of glypican-3 (GPC3) in lung squamous cell carcinoma and lung adenocarcinoma and its clinical significance.
26332121 2015 Human Monoclonal Antibody Targeting the Heparan Sulfate Chains of Glypican-3 Inhibits HGF-Mediated Migration and Motility of Hepatocellular Carcinoma Cells.
26256079 2015 Glypican-3 is a biomarker and a therapeutic target of hepatocellular carcinoma.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26052074 2015 T Cells Engineered to Express a T-Cell Receptor Specific for Glypican-3 to Recognize and Kill Hepatoma Cells In Vitro and in Mice.
More...