Property Summary

NCBI Gene PubMed Count 38
PubMed Score 22.56
PubTator Score 39.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.300 4.4e-04
group 3 medulloblastoma 1.400 1.3e-04
intraductal papillary-mucinous carcinoma... 1.300 5.6e-04
lung cancer 1.400 4.4e-04
medulloblastoma, large-cell 1.100 8.3e-04
Multiple myeloma 1.713 1.6e-04
ovarian cancer 2.400 5.4e-06
pancreatic ductal adenocarcinoma liver m... 1.274 5.6e-03
subependymal giant cell astrocytoma 1.034 4.9e-02

Protein-protein Interaction (5)

Gene RIF (20)

AA Sequence

MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI      1 - 70
SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH     71 - 140
VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW    141 - 210
NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS    211 - 280
PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP    281 - 350
KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL                          351 - 398
//

Text Mined References (44)

PMID Year Title