Property Summary

NCBI Gene PubMed Count 38
Grant Count 9
R01 Count 9
Funding $979,000
PubMed Score 22.56
PubTator Score 39.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26306039 DAP3 plays important roles in mitochondrial function and dynamics
25738636 DAP3 silencing contributes to breast carcinogenesis.
24300973 Knockdown of DAP3 expression promoted cell migration.
22287761 Study demonstrates an inverse association between DAP3 mRNA levels and tumour stage and clinical outcome in breast cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20563667 identified a novel DAP3-binding protein termed death ligand signal enhancer (DELE); results demonstrated the biological significance of DELE for apoptosis signal mediated by death receptors
19644511 show that interferon-beta promoter stimulator 1 (IPS-1) binds DAP3 and induces anoikis by caspase activation.
19536094 DAP3 may participate in mitochondrial maintenance and play a role in the balance between mitochondrial homoeostasis and tumourigenesis in thyroid oncocytic tumors.
19103604 Complex I and DAP3, hNOA1 may play a role in mitochondrial respiration and apoptosis.
19064571 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI      1 - 70
SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH     71 - 140
VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW    141 - 210
NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS    211 - 280
PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP    281 - 350
KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL                          351 - 398
//

Text Mined References (43)

PMID Year Title
26306039 2015 Death-associated Protein 3 Regulates Mitochondrial-encoded Protein Synthesis and Mitochondrial Dynamics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25738636 2015 Effects of the knockdown of death-associated protein 3 expression on cell adhesion, growth and migration in breast cancer cells.
24300973 2014 Death-associated protein-3, DAP-3, correlates with preoperative chemotherapy effectiveness and prognosis of gastric cancer patients following perioperative chemotherapy and radical gastrectomy.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22287761 2012 The mRNA expression of DAP3 in human breast cancer: correlation with clinicopathological parameters.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20563667 2010 Identification of DELE, a novel DAP3-binding protein which is crucial for death receptor-mediated apoptosis induction.
More...