Property Summary

NCBI Gene PubMed Count 38
Grant Count 30
R01 Count 20
Funding $2,349,768.47
PubMed Score 15.80
PubTator Score 15.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (5)

PMID Text
26612855 An accumulation of 8 SNPs in the fragile gene family (FMR1, FXR1 and FXR2)were found associated with autistic traits in a sample of male patients.
25496916 Fragile X mental retardation, autosomal homolog 2 (FXR2) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21072162 Data show that the nuclear localization signals of the FXR1 and FXR2 comprise tandem Tudor domain architectures.
20442204 These results indicate that FMR1 gene function is evolutionarily conserved in neural mechanisms and cannot be compensated by either FXR1 or FXR2, but that all three proteins can substitute for each other in non-neuronal requirements.
19487368 FXR1P and FXR2P KH2 domains bind G-quadruplex and kissing complex RNA with the same affinity as the FMRP KH2 domain.

AA Sequence

MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLPPPADYNKEIT      1 - 70
EGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLERLRPVNPNPLATKGSFFKVT     71 - 140
MAVPEDLREACSNENVHKEFKKALGANCIFLNITNSELFILSTTEAPVKRASLLGDMHFRSLRTKLLLMS    141 - 210
RNEEATKHLETSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPE    211 - 280
ACRQARSYLEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGT    281 - 350
RENISNAQALLEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLH    351 - 420
ATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEESRRRPTGGRGR    421 - 490
GPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPPASARRRRSRRRRTDEDRTVM    491 - 560
DGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLER    561 - 630
TKPSEDSLSGQKGDSVSKLPKGPSENGELSAPLELGSMVNGVS                               631 - 673
//

Text Mined References (50)

PMID Year Title
26612855 2015 Accumulated common variants in the broader fragile X gene family modulate autistic phenotypes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118916 2012 Genome-wide scan identifies variant in TNFSF13 associated with serum IgM in a healthy Chinese male population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...