Property Summary

NCBI Gene PubMed Count 46
PubMed Score 31.62
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 8.32503103016339E-32
non-small cell lung cancer 2798 8.1357178558214E-17
lung adenocarcinoma 2714 5.75159492559736E-9
lung cancer 4473 1.39179698778779E-5
ulcerative colitis 2087 1.62443523121908E-5
ovarian cancer 8492 5.19907302564363E-5
adrenocortical carcinoma 1427 3.21928968220532E-4
primary Sjogren syndrome 789 4.97882400093726E-4
pilocytic astrocytoma 3086 0.00120620953963603
interstitial cystitis 2299 0.00170700922338834
osteosarcoma 7933 0.00221960225241314
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00247728897034116
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00323574697964655
psoriasis 6685 0.00489252146804867
group 4 medulloblastoma 1875 0.00679280022405772
medulloblastoma, large-cell 6234 0.00846364070314434
oligodendroglioma 2849 0.0140896512410022
subependymal giant cell astrocytoma 2287 0.0159197683808959
primary pancreatic ductal adenocarcinoma 1271 0.0172857103210049
gastric carcinoma 832 0.0276728358229481
Disease Target Count Z-score Confidence
Cancer 2346 3.109 1.6

Expression

Synonym

Accession P50749 A6NIX9 A8K5Z3 Q17S06 Q53HD0 Q6AHZ2 Q8IZA5
Symbols CENP-34
RASFADIN

Gene

PANTHER Protein Class (2)

  Ortholog (11)

 GO Function (1)

Gene RIF (29)

PMID Text
26482475 our results suggest that RASSF2 may function as a tumor suppressor gene
26284587 RASSF2 gene is differently methylated in luminal and non-luminal tumors and is a promising suppressor gene with clinical involvement in breast cancer
25621889 We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas
24606436 Epigenetic inactivation of RASSF2A through aberrant promoter methylation may play an important role in the pathogenesis of epithelial ovarian cancer.
24605823 Promoter hypermethylation of RASSF2A is observed in cervical cancer, while not in normal cervical tissues.
23887284 results suggest that both RASSF1A and RASSF2 are novel epigenetically inactivated tumor suppressor genes in Ewing sarcoma and RASSF2 methylation may have prognostic implications for ES patients
23542458 our results suggest that RASSF2 potentially functions as a new tumor-suppressor gene that is inactivated through hypermethylation in cervical cancer
21792082 Promoter hypermethylation of RASSF2A is observed in pancreatic ductal adenocarcinoma, while not in normal pancreatic tissue.
21409489 Hypermethylation of RASSF2 gene is associated with advanced gastric cancer.
20920251 Results suggest that RASSF2 encodes a novel epigenetically inactivated candidate tumor suppressor gene in thyroid carcinogenesis.
More...

AA Sequence

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM      1 - 70
QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL     71 - 140
MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN    141 - 210
KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM    211 - 280
PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI                            281 - 326
//

Text Mined References (50)

PMID Year Title
26482475 2016 Aberrant hypermethylation of RASSF2 in tumors and peripheral blood DNA as a biomarker for malignant progression and poor prognosis of esophageal squamous cell carcinoma.
26284587 2015 Differential involvement of RASSF2 hypermethylation in breast cancer subtypes and their prognosis.
25621889 2015 EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.
25416956 2014 A proteome-scale map of the human interactome network.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24606436 2014 Aberrant methylation of RASSF2A in tumors and plasma of patients with epithelial ovarian cancer.
24605823 2014 Aberrant promoter methylation and silencing of RASSF2A gene in cervical cancer.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23887284 2013 RASSF2 methylation is a strong prognostic marker in younger age patients with Ewing sarcoma.
More...