Property Summary

NCBI Gene PubMed Count 49
PubMed Score 31.95
PubTator Score 29.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.622 3.2e-04
Astrocytoma, Pilocytic 1.400 1.1e-03
gastric carcinoma 1.700 2.8e-02
group 4 medulloblastoma -1.500 6.8e-03
interstitial cystitis 1.800 1.7e-03
intraductal papillary-mucinous adenoma (... -1.800 3.2e-03
intraductal papillary-mucinous carcinoma... -1.900 2.5e-03
lung adenocarcinoma -1.700 5.8e-09
lung cancer -1.900 5.2e-05
lung carcinoma -3.000 8.3e-32
medulloblastoma, large-cell -1.600 8.5e-03
non-small cell lung cancer -1.913 8.1e-17
oligodendroglioma 2.200 1.4e-02
osteosarcoma -2.475 2.2e-03
ovarian cancer 2.400 5.2e-05
primary pancreatic ductal adenocarcinoma 1.035 1.7e-02
primary Sjogren syndrome 2.300 5.0e-04
psoriasis -1.100 4.9e-03
subependymal giant cell astrocytoma -1.754 1.6e-02
ulcerative colitis 2.300 1.6e-05

 GO Function (1)

Gene RIF (32)

AA Sequence

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM      1 - 70
QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL     71 - 140
MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN    141 - 210
KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM    211 - 280
PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI                            281 - 326
//

Text Mined References (53)

PMID Year Title