Property Summary

NCBI Gene PubMed Count 20
Grant Count 47
R01 Count 29
Funding $4,326,648.87
PubMed Score 250.61
PubTator Score 225.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.300 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
group 4 medulloblastoma -1.600 0.000
invasive ductal carcinoma -1.021 0.013

Gene RIF (8)

PMID Text
26097063 ERF-related craniosynostosis should be suspected in patients presenting with multiple suture or sagittal synostosis
23354439 This work identifies ERF as a novel regulator of osteogenic stimulation by RAS-ERK signaling, potentially by competing with activating ETS factors in multifactor transcriptional complexes
22198386 Data demonstrate that induction of EGR1 involves ERK-mediated down-regulation of microRNA-191 and phosphorylation of the ETS2 repressor factor (ERF) repressor, which subsequently leaves the nucleus.
17699159 Erf provides a direct link between the RAS/ERK signaling and the transcriptional regulation of c-Myc and suggests that RAS/ERK attenuation actively regulates cell fate
17525531 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
14678752 Chromosome 21 transcription factor Ets2, overexpressed in Down syndrome, is expressed in neurons. Overexpression causes increased apoptosis of neurons from Ets2 transgenic mice and also involves activation of caspase-3.
14611815 a complex interplay between Ets/Id family members and c-Myc that may be an important determinant of the diversity of telomerase activity in leukemia and other cancers
12533699 Ets-2 Repressor Factor (ERF) physically interacts with the cytomegalovirus major immediate-early promoter (MIEP) and represses MIEP activity in undifferentiated non-permissive T2 embryonal carcinoma cells

AA Sequence

MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVR      1 - 70
KCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFIDVGLAGGAVPQSAPPVPSGGS     71 - 140
HFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPG    141 - 210
PPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPS    211 - 280
PTLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPL    281 - 350
PPMAPETPPVPSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPP    351 - 420
PPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPLKLRFKRRWSE    421 - 490
DCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQLSLEHRDS                491 - 548
//

Text Mined References (27)

PMID Year Title
26097063 2015 Heterozygous mutations in ERF cause syndromic craniosynostosis with multiple suture involvement.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23354439 2013 Reduced dosage of ERF causes complex craniosynostosis in humans and mice and links ERK1/2 signaling to regulation of osteogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22198386 2012 EGR1 and the ERK-ERF axis drive mammary cell migration in response to EGF.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17699159 2007 The RAS-dependent ERF control of cell proliferation and differentiation is mediated by c-Myc repression.
More...