Property Summary

NCBI Gene PubMed Count 36
PubMed Score 139.15
PubTator Score 105.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 2.100 4.0e-07
lung cancer 1.700 4.7e-04
malignant mesothelioma 1.100 5.4e-03
psoriasis -1.100 4.7e-05

 OMIM Phenotype (1)

Gene RIF (25)

AA Sequence

MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPA      1 - 70
DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALG     71 - 140
LHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQL    141 - 210
DQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML    211 - 280
TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD    281 - 350
LRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ                       351 - 401
//

Text Mined References (40)

PMID Year Title