Property Summary

NCBI Gene PubMed Count 32
Grant Count 75
R01 Count 47
Funding $8,183,258.42
PubMed Score 132.87
PubTator Score 105.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.005
lung cancer 1.700 0.000
lung adenocarcinoma 2.100 0.000
psoriasis -1.100 0.000

Synonym

Accession P50219 F5H401 Q9Y648
Symbols HB9
HLXB9
SCRA1
HOXHB9

Gene

Gene RIF (21)

PMID Text
25136833 The nuclear positioning of the HLXB9 gene was monitored at different stages.
24425879 Both pHLXB9 and active GSK-3beta are elevated in beta cells with menin knockdown, in MEN1-associated beta cell tumors (insulinomas)
24411943 NKX2-2 and MNX1 are etiological genes for neonatal diabetes.
24095820 study reports the results of MNX1 mutational screening in a series of 28 cases suspected having Currarino Syndrome and characterization of 10 novel mutations
23370340 study describes a Norwegian family with typical Currarino syndrome in which a heterozygous deletion removes the entire MNX1 gene but no other known genes; also report MNX1 mutations in 3other Norwegian families and confirm that the GCC12 repeat (c.373_375[12]) is a normal allelic variant
23048027 HB9 binds to the prostaglandin E receptor 2 promoter and inhibits intracellular cAMP mobilization in leukemic cells.
22820079 two novel mutations in the MNX1 gene in cases with Currarino syndrome
21960426 a new HLXB9 gene mutation identified in a Chinese family with members suffering from Currarino syndrome
21763840 2 previously described mutations, 1 de novo nonsense mutation (p.Gln212X) & 1 maternally inherited frameshift mutation (p.Pro18ProfsX38)were found among 14 Currarino syndrome patients with presacral tumors.
21069786 Hypermethylation of HLXB9 results in loss of expression and is associated with acute lymphoblastic leukemia.
More...

AA Sequence

MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPA      1 - 70
DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALG     71 - 140
LHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQL    141 - 210
DQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML    211 - 280
TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD    281 - 350
LRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ                       351 - 401
//

Text Mined References (36)

PMID Year Title
25136833 2014 HLXB9 gene expression, and nuclear location during in vitro neuronal differentiation in the SK-N-BE neuroblastoma cell line.
24425879 2014 GSK-3? protein phosphorylates and stabilizes HLXB9 protein in insulinoma cells to form a targetable mechanism of controlling insulinoma cell proliferation.
24411943 2014 Analysis of transcription factors key for mouse pancreatic development establishes NKX2-2 and MNX1 mutations as causes of neonatal diabetes in man.
24095820 2013 Novel MNX1 mutations and clinical analysis of familial and sporadic Currarino cases.
23370340 2013 A 5.8 kb deletion removing the entire MNX1 gene in a Norwegian family with Currarino syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23048027 2012 Homeobox protein HB9 binds to the prostaglandin E receptor 2 promoter and inhibits intracellular cAMP mobilization in leukemic cells.
22820079 2012 Novel mutations in the MNX1 gene in two families with Currarino syndrome and variable phenotype.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21960426 2012 A novel HLXB9 mutation in a Chinese family with Currarino syndrome.
More...