Property Summary

Ligand Count 14
NCBI Gene PubMed Count 32
PubMed Score 98.64
PubTator Score 108.17

Knowledge Summary

Patent (10,809)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Fructosuria 1 0.0 0.0
Disease Target Count
Deficiency of fructokinase 1
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
fructose-1,6-bisphosphatase deficiency 7 5.323 2.7

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-03
astrocytoma -1.100 2.5e-03
atypical teratoid / rhabdoid tumor -1.600 2.9e-07
lung cancer 1.200 3.1e-03
medulloblastoma -1.100 5.2e-05
medulloblastoma, large-cell -1.200 3.3e-05
nephrosclerosis -1.433 8.9e-04
pancreatic ductal adenocarcinoma liver m... -1.323 6.9e-03

Protein-protein Interaction (1)

PDB (19)

Gene RIF (13)

AA Sequence

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVAD      1 - 70
FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEG     71 - 140
RNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG    141 - 210
LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRF    211 - 280
GCQVAGKKCGLQGFDGIV                                                        281 - 298
//

Text Mined References (34)

PMID Year Title