Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.99
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -2.286 0.000
tuberculosis -2.300 0.000
fibroadenoma 1.200 0.014
posterior fossa group B ependymoma 1.600 0.000
spina bifida -2.871 0.040
invasive ductal carcinoma 1.400 0.010
ovarian cancer 1.100 0.003

Gene RIF (2)

PMID Text
26567849 ZNF165 drives the unrestrained activation of transforming growth factor beta (TGFbeta) signalling by directly inactivating the expression of negative feedback pathway regulators, SMURF2, SMAD7 and PMEPA1.
25214475 ZNF165 mRNA/protein expression was observed in TCC of human urinary bladder and might be used as a novel diagnostic biomarker and as well a vaccine target in development of urinary bladder cancer specific immunotherapy.

AA Sequence

MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDSPGPREALSRL      1 - 70
RELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEAVTILEDLERGTDEAVLQVQA     71 - 140
HEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISG    141 - 210
RISGYISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLN    211 - 280
LNSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECG    281 - 350
KAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR    351 - 420
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMRENLLM         421 - 485
//

Text Mined References (10)

PMID Year Title
26567849 2015 Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer.
25214475 2015 Frequent expression of zinc-finger protein ZNF165 in human urinary bladder transitional cell carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076058 2000 Familial t(6;21)(p21.1;p13) translocation associated with male-only sterility.
9244436 1997 Three genes encoding zinc finger proteins on human chromosome 6p21.3: members of a new subclass of the Kruppel gene family containing the conserved SCAN box domain.
8673473 1995 A strategy for cloning the hereditary hemochromatosis gene.
7490084 1995 Characterization of a novel zinc finger gene (ZNF165) mapping to 6p21 that is expressed specifically in testis.