Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.99
PubTator Score 9.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.7
Disease Target Count Z-score Confidence
Suppurative thyroiditis 4 4.769 2.4

Expression

  Differential Expression (8)

Disease log2 FC p
fibroadenoma 1.200 1.4e-02
invasive ductal carcinoma 1.400 9.7e-03
malignant mesothelioma 1.200 2.9e-06
osteosarcoma -2.286 1.5e-08
ovarian cancer 1.100 3.2e-03
posterior fossa group A ependymoma 1.100 6.9e-05
spina bifida -2.871 4.0e-02
tuberculosis -2.300 8.8e-07

Gene RIF (2)

AA Sequence

MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDSPGPREALSRL      1 - 70
RELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEAVTILEDLERGTDEAVLQVQA     71 - 140
HEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISG    141 - 210
RISGYISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLN    211 - 280
LNSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECG    281 - 350
KAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR    351 - 420
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMRENLLM         421 - 485
//

Text Mined References (13)

PMID Year Title