Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 2
Funding $516,806
PubMed Score 49.10
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.501 0.000
group 3 medulloblastoma 1.500 0.002
atypical teratoid / rhabdoid tumor 1.400 0.000
lung cancer 1.300 0.007
non primary Sjogren syndrome sicca 1.100 0.022
invasive ductal carcinoma 1.100 0.039
ovarian cancer 1.200 0.002

Synonym

Accession P49903 B4DWK0 D3DRS9 D6PSQ9 Q5T5U8 Q5T5U9 Q9BVT4
Symbols SPS
SELD
SPS1

Gene

PANTHER Protein Class (1)

PDB

3FD5   3FD6  

Gene RIF (5)

PMID Text
23112913 Three SNPs in SEPSECS and SEPHS1 were found to significantly interact with serum selenium level and Crohn's Disease.
20471958 Five alternative splice variants of human SPS1 (major type, DeltaE2, DeltaE8, +E9, +E9a) were identified wherein +E9 and +E9a make the same protein.
16786570 Sps1 affect cell viability upon ionizing radiation via modulation of p53 activity. Sps1 and its product selenophosphate might be involved in cancer prevention in a p53-dependent manner and could be applied to development of a novel cancer therapy.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15534230 the Sps1-encoded enzyme depends on a selenium salvage system that recycles l-selenocysteine, whereas the Sps2 enzyme can function with a selenite assimilation system

AA Sequence

MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT      1 - 70
CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV     71 - 140
MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA    141 - 210
VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK    211 - 280
QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ    281 - 350
AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS                                351 - 392
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23112913 2012 Selenium, selenoprotein genes and Crohn's disease in a case-control population from Auckland, New Zealand.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20471958 2010 Human selenophosphate synthetase 1 has five splice variants with unique interactions, subcellular localizations and expression patterns.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19477186 2009 Crystal structures of catalytic intermediates of human selenophosphate synthetase 1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...