Property Summary

NCBI Gene PubMed Count 78
Grant Count 39
R01 Count 25
Funding $4,948,558.87
PubMed Score 124.63
PubTator Score 87.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease -1.100 0.033
Waldenstrons macroglobulinemia 1.156 0.043
Multiple myeloma 1.896 0.000
psoriasis 1.500 0.000
osteosarcoma 1.155 0.000
Amyotrophic Lateral Sclerosis 1.133 0.000
sonic hedgehog group medulloblastoma 1.100 0.001
ovarian cancer 2.500 0.001
dermatomyositis 1.600 0.000

Gene RIF (70)

PMID Text
26051542 Nucleoporin Nup153 is required for NPC assembly during interphase but not during mitotic exit. It functions in interphasic NPC formation by binding directly to the inner nuclear membrane via an N-terminal amphipathic helix.
26030189 Study assessed the extent of collapse of a Nup153 fragment in molecular dynamics simulations and compared the results to single molecule FRET and small-angle X-ray scattering experiments of this peptide
25731161 Knockdown of nucleoporin 153kDa (NUP153) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
25518861 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25518861 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25485891 Our data indicate a central function of Nup153 in the organization of the nucleus, not only at the periphery, but throughout the entire nuclear interior.
25410863 The data presented here suggest that BGLF4 interferes with the normal functions of Nup62 and Nup153 and preferentially helps the nuclear import of viral proteins for viral DNA replication and assembly.
25356722 NUP153 and CPSF6 have overlapping binding sites, but each makes unique capsid monomers (CA) interactions. Multiple ligands share an overlapping interface in HIV-1 capsid that is lost upon viral disassembly.
25356722 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25356722 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
More...

AA Sequence

MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFNKNEDVCSCST      1 - 70
DTSEVPRWPENKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTASNYPDVLTRPSLHRSHLNFSM     71 - 140
LESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDNISTTSGFSSRASDKDITVSKNTSLPPLWSP    141 - 210
EAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRN    211 - 280
TPYQAPVRRQMKAKQLSAQSYGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDF    281 - 350
QAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQ    351 - 420
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFS    421 - 490
SPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVLPPSSIGFTFSVPVAKTAELS    491 - 560
GSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPAEILKEGSVLDILKSPGFASPKIDSVAAQPT    561 - 630
ATSPVVYTRPAISSFSSSGIGFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETP    631 - 700
NKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETM    701 - 770
TASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSG    771 - 840
GSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAASSSFKFGVSSS    841 - 910
SSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDN    911 - 980
FKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIVTSENKSSFNL    981 - 1050
GTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGK   1051 - 1120
KADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVF   1121 - 1190
SFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKL   1191 - 1260
ATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQS   1261 - 1330
QGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSS   1331 - 1400
TTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTA   1401 - 1470
VRRRK                                                                    1471 - 1475
//

Text Mined References (98)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26051542 2015 Nup153 Recruits the Nup107-160 Complex to the Inner Nuclear Membrane for Interphasic Nuclear Pore Complex Assembly.
26030189 2015 Kirkwood-Buff Approach Rescues Overcollapse of a Disordered Protein in Canonical Protein Force Fields.
25485891 2014 Structural characterization of altered nucleoporin Nup153 expression in human cells by thin-section electron microscopy.
25410863 2015 BGLF4 kinase modulates the structure and transport preference of the nuclear pore complex to facilitate nuclear import of Epstein-Barr virus lytic proteins.
25356722 2014 Host cofactors and pharmacologic ligands share an essential interface in HIV-1 capsid that is lost upon disassembly.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24739174 2014 Karyopherin-centric control of nuclear pores based on molecular occupancy and kinetic analysis of multivalent binding with FG nucleoporins.
24418548 2014 Nuclear import of cutaneous beta genus HPV8 E7 oncoprotein is mediated by hydrophobic interactions between its zinc-binding domain and FG nucleoporins.
More...