Property Summary

NCBI Gene PubMed Count 50
Grant Count 135
R01 Count 69
Funding $11,970,336.82
PubMed Score 225.70
PubTator Score 261.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.872 1.9
Herpes simplex 19 3.383 1.7

Expression

Synonym

Accession P49771 A0AVC2 B9EGH2 Q05C96 Flt3 ligand
Symbols FL
FLT3L

Gene

PDB

1ETE   3QS7   3QS9  

 GO Function (1)

Gene RIF (36)

PMID Text
26559027 serum levels can be a marker of cutaneous manifestation in dermatomyositis and marker of microangiopathy in systemic sclerosis
26521986 Pre-treatment serum levels of FLT3-L were higher than controls. FLT3-L correlated positively with all soluble angiogenic factors, as well with bone marrow microvascular density. Post-treatment FLT3-L decreased significantly in responders to therapy.
25135299 Flt3L enhances global T cell and humoral immunity as well as both the numbers and antigen capture capacity of migratory dendritic cells and classical lymphoid-resident dendritic cells
24419512 The immunohistochemical expression of caveolin-1 and podocalyxin in lungs from rats challenged with a 2-kDa macrophage-activating lipopeptide (MALP-2) and Flt3L, was examined.
24314260 The Flt3L/CD135 axis is active in rheumatoid arthritis
23124877 Administration of the hematopoietic growth factor Flt3L to human subjects increases the frequency and absolute number of Treg cells.
22463758 Human bone marrow stromal cells simultaneously support B and T/NK lineage development from human haematopoietic progenitors: a principal role for flt3 ligand in lymphopoiesis.
22110249 A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation.
21516120 FLT3 ligand(FL) leads to further activation of FLT3 mutants and is especially important in light of recent findings of elevated FL levels in acute myeloid leukemia patients in response to chemotherapy.
21505426 data demonstrate that the Flt3L/TK gene therapeutic approach can induce systemic immunological memory capable of recognizing a brain tumor neoantigen in a model of recurrent GBM
More...

AA Sequence

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC      1 - 70
GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA     71 - 140
LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT    141 - 210
RRRTPRPGEQVPPVPSPQDLLLVEH                                                 211 - 235
//

Text Mined References (52)

PMID Year Title
26559027 2015 Serum concentrations of Flt-3 ligand in rheumatic diseases.
26521986 2015 Potential role of FLT3-ligand in the angiogenic process of multiple myeloma.
25135299 2014 Classical Flt3L-dependent dendritic cells control immunity to protein vaccine.
24419512 2014 Expression of caveolin-1 and podocalyxin in rat lungs challenged with 2-kDa macrophage-activating lipopeptide and Flt3L.
24314260 2013 FMS-related tyrosine kinase 3 ligand (Flt3L)/CD135 axis in rheumatoid arthritis.
23124877 2013 Flt3 ligand expands CD4+ FoxP3+ regulatory T cells in human subjects.
22463758 2012 Human bone marrow stromal cells simultaneously support B and T/NK lineage development from human haematopoietic progenitors: a principal role for flt3 ligand in lymphopoiesis.
22110249 2012 Blockade of prostaglandin E2 signaling through EP1 and EP3 receptors attenuates Flt3L-dependent dendritic cell development from hematopoietic progenitor cells.
21516120 2011 Further activation of FLT3 mutants by FLT3 ligand.
21505426 2011 Combined Flt3L/TK gene therapy induces immunological surveillance which mediates an immune response against a surrogate brain tumor neoantigen.
More...