Property Summary

NCBI Gene PubMed Count 52
PubMed Score 235.18
PubTator Score 261.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.91 2.0
Herpes simplex 18 3.37 1.7

Expression

Gene RIF (38)

AA Sequence

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC      1 - 70
GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA     71 - 140
LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT    141 - 210
RRRTPRPGEQVPPVPSPQDLLLVEH                                                 211 - 235
//

Text Mined References (54)

PMID Year Title