Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.10
PubTator Score 9.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Myocardial Ischemia 169
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession P49753 Q3I5F8 Q53EK4 Q9NUX4 Acyl-CoA thioesterase 2
Symbols MTE1
PTE2
CTE1A
PTE2A
CTE-IA
ZAP128

Gene

PDB

3HLK  

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19497300 the crystal structure at 2.1A resolution of human mitochondrial ACOT2, a type I enzyme is reported.

AA Sequence

MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPARMAATLILE      1 - 70
PAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGGSFAGLEPM     71 - 140
GLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCQTRHERYFLPPGVRREPVRVGRVRGTL    141 - 210
FLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEEAMNYLLSH    211 - 280
PEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDG    281 - 350
YADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPET    351 - 420
GHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSKV           421 - 483
//

Text Mined References (16)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19497300 2009 Crystal structure of human mitochondrial acyl-CoA thioesterase (ACOT2).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16940157 2006 Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15007068 2004 Molecular cloning and characterization of two mouse peroxisome proliferator-activated receptor alpha (PPARalpha)-regulated peroxisomal acyl-CoA thioesterases.
More...