Property Summary

NCBI Gene PubMed Count 116
Grant Count 104
R01 Count 57
Funding $24,777,445.34
PubMed Score 502.11
PubTator Score 414.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49747 B4DKJ3 O14592 Q16388 Q16389 Q2NL86 Q8N4T2 COMP
Symbols MED
EDM1
EPD1
TSP5
PSACH
THBS5

Gene

PDB

3FBY  

Gene RIF (83)

PMID Text
27455560 The expression of COMP in circulation reflects the severity of rheumatoid arthritis.
26848781 Serum COMP levels are predictive of subsequent structural changes and incidence of painful knee osteoarthritis.
26269256 findings suggest that Cartilage oligomeric matrix protein (COMP) is associated with the stage of liver fibrosis in chronic hepatitis C
26168731 determined if structural differences of the TSPs imparted different effects on vascular smooth muscle cell functions critical to the formation of neointimal hyperplasia
25835418 The GG genotype of Med23 gene associate with Cognitive Decline and Dementia.
25430711 Overexpression of COMP inhibits BMP-2-induced osteogenic differentiation and promotes BMP-2-induced chondrogenic differentiation.
25380520 Real-time polymerase chain reaction (RT-PCR) assay presented significantly higher (p<0.01) COMP expression of mesenchymal stem cells cultured with HA/COMP multilayered films.
25111190 COMP does not directly modify the expression of genes involved in cartilage homeostasis in contrast to several other cartilage matrix proteins.
24917676 Novel cartilage oligomeric matrix protein (COMP) neoepitopes identified in synovial fluids from patients with joint diseases using affinity chromatography and mass spectrometry.
24907621 Serum COMP was not acutely influenced by experimental anterior knee pain during running.
More...

AA Sequence

MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD      1 - 70
ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRV     71 - 140
RCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQ    141 - 210
PGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKL    211 - 280
RCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDN    281 - 350
CRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD    351 - 420
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNP    421 - 490
GQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI    491 - 560
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAV    561 - 630
AEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFY    631 - 700
EGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA                 701 - 757
//

Text Mined References (118)

PMID Year Title
27455560 2016 [THE COMPARATIVE ANALYSIS OF LEVEL OF OLIGOMERIC MATRIX PROTEIN OF CARTILAGE IN BLOOD SERUM OF PATIENTS WITH DISEASES OF MUSCULO-SKELETAL SYSTEM].
26848781 2015 Serum cartilage oligomeric matrix protein and development of radiographic and painful knee osteoarthritis. A community-based cohort of middle-aged women.
26269256 2015 Cartilage oligomeric matrix protein: a new promising biomarker of liver fibrosis in chronic hepatitis C.
26168731 2015 Thrombospondin-1, -2 and -5 have differential effects on vascular smooth muscle cell physiology.
25835418 2015 Variants in Antiviral Genes are Risk Factors for Cognitive Decline and Dementia.
25430711 2014 Effects of cartilage oligomeric matrix protein on bone morphogenetic protein-2-induced differentiation of mesenchymal stem cells.
25416956 2014 A proteome-scale map of the human interactome network.
25380520 2014 Cartilage oligomeric matrix protein gene multilayers inhibit osteogenic differentiation and promote chondrogenic differentiation of mesenchymal stem cells.
25111190 COMP does not directly modify the expression of genes involved in cartilage homeostasis in contrast to several other cartilage matrix proteins.
25057126 2014 Meta-analysis identifies loci affecting levels of the potential osteoarthritis biomarkers sCOMP and uCTX-II with genome wide significance.
More...