Property Summary

NCBI Gene PubMed Count 126
PubMed Score 538.28
PubTator Score 414.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Abnormal development of end part of bone 14
Abnormality of epiphysis morphology 39
Abnormality of the hip bone 16
Abnormality of the metaphyses 48
Acquired scoliosis 281
Arthralgia 90
Beaked vertebral bodies 9
Brachydactyly 156
Broad femoral neck 4
Bullet vertebral body 17
Carpal bone hypoplasia 6
Cervical cord compression 2
Curvature of spine 282
Decreased joint mobility 53
Degenerative polyarthritis 115
Delayed bone age 136
Delayed epiphyseal ossification 10
Delayed maturation of end part of long bone 10
Epiphyseal dysplasia 14
Flared femoral metaphysis 2
Fragmented epiphyses 1
Fragmented, irregular epiphyses 1
Gait abnormality 135
Gastrointestinal hamartomatous polyps 10
Gastrointestinal polyps 5
Generalized joint laxity 6
Genu recurvatum 12
Genu varum 29
Hamartomatous polyp 10
Hip Dislocation, Congenital 48
Hyperkyphosis 111
Hypoplastic feet 66
Intestinal Polyposis 6
Irregular carpal bones 2
Irregular epiphyses 10
Irregular vertebral endplates 16
Joint hyperflexibility 78
Joint laxity 54
Joint stiffness 84
Knee joint valgus deformity 56
Kyphosis deformity of spine 114
Legg-Calve-Perthes disease 14
Limited elbow extension 19
Limited hip extension 4
Limited hip movement 4
Lordosis 54
Lumbar lordosis 35
Micromelia 58
ODONTOID HYPOPLASIA 16
Osteoarthritis of hip 6
Ovoid vertebral bodies 17
Platyspondyly 56
Radial metaphyseal irregularity 1
Relative short stature 13
Sensory neuropathy 20
Short distal phalanges 50
Short femoral neck 15
Short hands 50
Short limb dwarfism, disproportionate 22
Short metacarpal 43
Short phalanx of finger 32
Short stature, mild 13
Short tubular bones 22
Short-limb dwarfism identifiable during childhood 2
Small epiphyses 9
Small epiphyses of the phalanges of the hand 1
Small wrist bones 6
Spatulated ribs 1
Ulnar deviation of hand 9
Ulnar deviation of the wrist 8
Ulnar metaphyseal irregularity 1
Waddling gait 34
Wedging of vertebra 9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Multiple epiphyseal dysplasia 18 7.327 3.7

Expression

  Differential Expression (17)

Gene RIF (92)

AA Sequence

MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD      1 - 70
ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRV     71 - 140
RCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQ    141 - 210
PGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKL    211 - 280
RCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDN    281 - 350
CRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD    351 - 420
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNP    421 - 490
GQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI    491 - 560
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAV    561 - 630
AEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFY    631 - 700
EGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA                 701 - 757
//

Text Mined References (128)

PMID Year Title