Property Summary

NCBI Gene PubMed Count 72
PubMed Score 103.66
PubTator Score 94.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.900 4.9e-05
Breast cancer -1.100 1.3e-08
cystic fibrosis 1.300 6.5e-04
glioblastoma 1.100 2.7e-02
interstitial cystitis -2.100 1.1e-03
non-small cell lung cancer 1.486 2.8e-11
posterior fossa group A ependymoma 1.500 2.2e-07

Protein-protein Interaction (1)

Gene RIF (56)

AA Sequence

MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHH      1 - 70
HHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMV     71 - 140
QHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKV    141 - 210
KRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNR    211 - 280
RMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH                   281 - 335
//

Text Mined References (73)

PMID Year Title