Property Summary

NCBI Gene PubMed Count 67
Grant Count 69
R01 Count 34
Funding $11,214,935.85
PubMed Score 92.85
PubTator Score 94.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.100 0.027
non-small cell lung cancer 1.486 0.000
interstitial cystitis -2.100 0.001
cystic fibrosis 1.300 0.001
adult high grade glioma 1.900 0.000
posterior fossa group A ependymoma 1.500 0.000
Breast cancer -1.100 0.000

Synonym

Accession P49639 A4D184 B2R8U7 O43363
Symbols BSAS
HOX1
HOX1F

Gene

Gene RIF (54)

PMID Text
26791264 Data indicated that HOXA1 and CCND1 mRNA and protein expression were higher in gastric cancer (GC) tissues, that a significant correlation was found between their expression, and they both may serve as a novel prognostic biomarker for GC.
26707824 Studied HOTAIR in chemoresistance of SCLC and possible molecular mechanism. Knockdown of HOTAIR was carried out in SCLC multidrug-resistant cell lines; found depletion of HOTAIR reduced HOXA1 methylation by decreasing DNMT1 & DNMT3b expression.
26417931 MicroRNA-99a inhibits tumor aggressive phenotypes through regulating HOXA1 in breast cancer cells.
26135141 our findings suggest that HOXA1 is involved in the regulation of prostate cancer progression, including cell growth, migration, invasion and metastasis
25691658 YAP regulates the expression of HOXA1 and HOXC13 in human keratinocytes.
25472883 HIV-1 Tat specifically associates with HOXA1 promoter to upregulate HOXA1 expression in T cells
25148682 ACK1 interacts with KDM3A to regulate the mammary tumor oncogene HOXA1.
25069511 Analysis indicates that the genes BIRC5, HOXA1 and RARB are critical targets that play an important regulatory role in cervical cancer pathogenesis.
24878468 In a Middle Eastern population, HOXA1 is not likely a common cause of non-syndromic deafness.
24789793 The results demonstrated that miR-181c transcription is suppressed and HOXA1 expression is enhanced in hepatitis C virus-infected hepatocytes.
More...

AA Sequence

MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHH      1 - 70
HHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMV     71 - 140
QHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKV    141 - 210
KRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNR    211 - 280
RMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH                   281 - 335
//

Text Mined References (68)

PMID Year Title
26791264 2016 Elevated HOXA1 expression correlates with accelerated tumor cell proliferation and poor prognosis in gastric cancer partly via cyclin D1.
26707824 2016 Long noncoding RNA-HOTAIR affects chemoresistance by regulating HOXA1 methylation in small cell lung cancer cells.
26417931 2015 MicroRNA-99a inhibits tumor aggressive phenotypes through regulating HOXA1 in breast cancer cells.
26135141 2015 HOXA1 enhances the cell proliferation, invasion and metastasis of prostate cancer cells.
25691658 2015 YAP regulates the expression of Hoxa1 and Hoxc13 in mouse and human oral and skin epithelial tissues.
25416956 2014 A proteome-scale map of the human interactome network.
25148682 2014 ACK1 tyrosine kinase interacts with histone demethylase KDM3A to regulate the mammary tumor oncogene HOXA1.
25069511 2014 Identification of critical microRNA gene targets in cervical cancer using network properties.
24878468 2014 HOXA1 Mutations are Not Commonly Associated with Non-Syndromic Deafness.
24789793 2014 Transcriptional suppression of miR-181c by hepatitis C virus enhances homeobox A1 expression.
More...