Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.21
PubTator Score 24.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 0.00120315916436899
Disease Target Count Z-score Confidence
Sclerosteosis 9 3.521 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 2.000 0.001

Synonym

Accession P49458 A8K0N0 Q6NVX0 Q8WTW0 SRP9
Symbols ALURBP

Gene

PDB

1E8O   1E8S   1RY1   4UYJ   4UYK   5AOX  

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (5)

PMID Text
25697503 Dats show that Alu RNA promotes functional binding of Signal Recognition Particle proteins SRP9/14 to 40S ribosomal subunits.
22174317 HIV-1 Rev interacting protein, signal recognition particle 9kDa (SRP9), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SRP9 is increased by RRE
20348448 mutational study on SRP9/14 that identified and characterized regions and single residues essential for elongation arrest activity
18549262 PSB7, PRDX1, and SRP9 up-regulation as candidate biomarkers of colon cancer is discovered
12775420 HIV-1 Rev interacting protein, signal recognition particle 9kDa (SRP9), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SRP9 is increased by RRE

AA Sequence

MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLM      1 - 70
RLMVAKEARNVTMETE                                                           71 - 86
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25697503 2015 Alu RNA regulates the cellular pool of active ribosomes by targeted delivery of SRP9/14 to 40S subunits.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20348448 2010 Residues in SRP9/14 essential for elongation arrest activity of the signal recognition particle define a positively charged functional domain on one side of the protein.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18549262 2008 Proteomic expression analysis of surgical human colorectal cancer tissues: up-regulation of PSB7, PRDX1, and SRP9 and hypoxic adaptation in cancer.
More...