Property Summary

NCBI Gene PubMed Count 17
PubMed Score 31.79
PubTator Score 24.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 1.2e-03
Disease Target Count Z-score Confidence
SOST-related sclerosing bone dysplasia 8 3.906 2.0
Sclerosteosis 9 3.515 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 2.000 1.2e-03

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (5)

AA Sequence

MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLM      1 - 70
RLMVAKEARNVTMETE                                                           71 - 86
//

Text Mined References (23)

PMID Year Title