Property Summary

NCBI Gene PubMed Count 45
PubMed Score 61.89
PubTator Score 43.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.700 3.4e-02
astrocytic glioma 2.600 2.3e-02
atypical teratoid / rhabdoid tumor -2.200 1.7e-03
Breast cancer 1.100 3.0e-06
breast carcinoma 1.100 1.8e-02
ependymoma 1.700 3.5e-02
gastric cancer 1.300 1.8e-02
glioblastoma 1.400 1.5e-02
group 3 medulloblastoma 1.700 1.2e-04
interstitial lung disease 1.100 1.7e-02
juvenile dermatomyositis 1.193 1.7e-07
malignant mesothelioma 1.900 7.7e-08
medulloblastoma, large-cell 1.300 4.3e-04
Multiple myeloma 1.083 2.3e-03
oligodendroglioma 2.300 1.7e-02
osteosarcoma -2.168 1.7e-06
ovarian cancer -1.300 1.6e-04
pancreatic cancer 1.300 3.4e-02
pancreatic carcinoma 1.300 3.4e-02
Pick disease -1.500 3.9e-04
primitive neuroectodermal tumor 1.100 8.1e-04
progressive supranuclear palsy -1.600 8.9e-03
psoriasis -1.900 5.8e-05
Waldenstrons macroglobulinemia 1.462 1.3e-02

Gene RIF (16)

AA Sequence

MAMESTATAAVAAELVSADKIEDVPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAA      1 - 70
SLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAR     71 - 140
EELREQVYDAMGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEKVDLTLDWLTETS    141 - 210
EEAKGGAAPEGPNEAEVTSGKPEQEVPDAEEEKSVSGTDVQEECREKGGQEKQGEVIVSIEEKPKEVSEE    211 - 280
QPVVTLEKQGTAVEVEAESLDPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVTTE    281 - 350
AAEASAVEAGSEVSEKPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSIERLTETKDGSGLEEKVRAKLVP    351 - 420
SQEETKLSVEESEAAGDGVDTKVAQGATEKSPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKT    421 - 490
EEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYVQ    491 - 560
AVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQVKEAEG    561 - 630
SSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPT    631 - 700
DGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR    701 - 770
AAVEGTVEAGATVESTAC                                                        771 - 788
//

Text Mined References (57)

PMID Year Title