Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.30
PubTator Score 43.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.59562859931417E-8
malignant mesothelioma 3163 7.68767448616463E-8
juvenile dermatomyositis 1189 1.69634565470754E-7
osteosarcoma 7933 1.74991512792992E-6
Breast cancer 3099 3.00742406458203E-6
group 3 medulloblastoma 2254 2.00686649709072E-5
psoriasis 6685 5.84092950094237E-5
medulloblastoma, large-cell 6234 1.40453856720109E-4
Pick disease 1893 3.91583044520581E-4
primitive neuroectodermal tumor 3031 8.09992357541899E-4
atypical teratoid / rhabdoid tumor 4369 0.00167754680417243
glioblastoma 5572 0.00218884322338803
Multiple myeloma 1328 0.00229962268652199
progressive supranuclear palsy 674 0.00893704222368717
Waldenstrons macroglobulinemia 765 0.0126986208002711
oligodendroglioma 2849 0.0169356810443036
interstitial lung disease 292 0.0171838978864314
gastric cancer 436 0.0183244216731799
breast carcinoma 1614 0.0184769782886043
astrocytic glioma 2241 0.022741776122779
adult high grade glioma 2148 0.0335235401509031
pancreatic cancer 2300 0.0337042920527454
pancreatic carcinoma 567 0.0337042920527454
ependymoma 2514 0.0346650228519844
Disease Target Count Z-score Confidence
Acalculous cholecystitis 1 3.273 1.6

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 1.300 0.018
pancreatic cancer 1.300 0.034
interstitial lung disease 1.100 0.017
Waldenstrons macroglobulinemia 1.462 0.013
Multiple myeloma 1.083 0.002
malignant mesothelioma 1.900 0.000
astrocytic glioma 2.600 0.023
ependymoma 1.700 0.035
oligodendroglioma 2.300 0.017
psoriasis -1.900 0.000
glioblastoma -2.200 0.002
osteosarcoma -2.168 0.000
group 3 medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor -2.200 0.002
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor 1.100 0.001
juvenile dermatomyositis 1.193 0.000
breast carcinoma 1.100 0.018
adult high grade glioma -1.700 0.034
pancreatic carcinoma 1.300 0.034
Pick disease -1.500 0.000
progressive supranuclear palsy -1.600 0.009
Breast cancer 1.100 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P49321 A8K6H2 B4DQP3 D3DQ07 F5H3J2 Q53GW5 Q5T622 Q5T625 Q96A69 Q9BTW2 NASP
Symbols HMDRA1
FLB7527
PRO1999

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (16)

PMID Text
26673727 findings reveal a new mode of interaction between a TPR repeat domain of histone chaperone sNASP and an evolutionarily conserved peptide motif found in canonical H3 and in all histone H3 variants
25669170 Our research demonstrates that knockdown of tNASP effectively inhibits the proliferation and causes G1 phase arrest through ERK/MAPK signal pathway.
25615412 These results provide evidence that tNASP is ubiquitously produced in various types of human tissues and promotes in vitro nucleosome assembly with H3 variant specificity.
24951090 NASP family Proteins are highly conserved throughout the eukaryotes and posses four TPR motifs. It was likely present in the last common ancestor of eukaryotes possibly representing an important innovation regarding H3/H4 transport mechanism. Different TPR motifs in NASP have evolved at different rates with TPR1/4 evolving faster than TPR2/3.
23364796 HIV-1 Tat upregulates the expression of nuclear autoantigenic sperm protein (NASP) in Jurkat cells
22968912 Studies indicate that histone chalerones nucleoplasmin (NPM2/NPM3) preferentially associated with histones H2A-H2B in the egg and the nuclear autoantigenic sperm protein (NASP) families.
22944692 HIV-1 Tat upregulates the expression of nuclear autoantigenic sperm protein (NASP) in Jurkat cells
22195965 The insights into NASP function and the existence of a tunable reservoir in mammalian cells demonstrate that contingency is integrated into the histone supply chain to respond to unexpected changes in demand.
22194605 an increase of miR-29a, and hence decrease of Nasp, may contribute to inhibit cell proliferation during postnatal organ development.
21965532 sNASP interacts with linker and core histones through distinct structural domains.
More...

AA Sequence

MAMESTATAAVAAELVSADKIEDVPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAA      1 - 70
SLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAR     71 - 140
EELREQVYDAMGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEKVDLTLDWLTETS    141 - 210
EEAKGGAAPEGPNEAEVTSGKPEQEVPDAEEEKSVSGTDVQEECREKGGQEKQGEVIVSIEEKPKEVSEE    211 - 280
QPVVTLEKQGTAVEVEAESLDPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVTTE    281 - 350
AAEASAVEAGSEVSEKPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSIERLTETKDGSGLEEKVRAKLVP    351 - 420
SQEETKLSVEESEAAGDGVDTKVAQGATEKSPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKT    421 - 490
EEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYVQ    491 - 560
AVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQVKEAEG    561 - 630
SSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPT    631 - 700
DGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR    701 - 770
AAVEGTVEAGATVESTAC                                                        771 - 788
//

Text Mined References (54)

PMID Year Title
26673727 2016 The histone chaperone sNASP binds a conserved peptide motif within the globular core of histone H3 through its TPR repeats.
25669170 2015 Downregulation of tNASP inhibits proliferation through regulating cell cycle-related proteins and inactive ERK/MAPK signal pathway in renal cell carcinoma cells.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24951090 2014 Molecular evolution of NASP and conserved histone H3/H4 transport pathway.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22968912 2012 Vertebrate nucleoplasmin and NASP: egg histone storage proteins with multiple chaperone activities.
More...