Property Summary

NCBI Gene PubMed Count 22
Grant Count 15
R01 Count 1
Funding $3,083,322.75
PubMed Score 237.08
PubTator Score 40.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000

Gene RIF (11)

PMID Text
26084804 TGM4 is a prostatic secretory molecule with critical role in male reproduction.
23974364 indicated that transglutaminase 4 may serve as a potential predictor of biochemical recurrence of prostate cancer
22362749 Evidence that the retinoic acid receptor gamma plays a major role in the regulation of the hTGP gene and that presence of the androgen receptor, but not its transcriptional transactivation activity, is critical for hTGP transcription.
21743959 CDKN2A, GATA3, CREBBP, ITGA2, NBL1 and TGM4 were down-regulated in the prostate carcinoma glands compared to the corresponding normal glands
21524313 The presence of TGase-4 has a biological impact on a prostate cancer cell's response to MDA-7.
20596668 TGase-4 expression is intrinsically linked to the activation of RON in prostate cancer cells and that this autoactivation of RON contributes to the increased cell motility in TGase-4 expressing cells.
20177144 The expression status of human transglutaminase 4 in benign prostate hyperplasia (BPH) and prostate cancer was analyzed.
18983858 TGase-4 plays a pivotal role in the interaction between endothelial cells and prostate cancer cells, an action which is independent of the ROCK pathway.
17552366 transglutaminase 4 has a relatively wide profile of expression in human cancer cell lines
7906657 The HIV-1 transmembrane glycoprotein gp41 is an amino acceptor and donor substrate for transglutaminase in vitro; soluble CD4 can block the transglutaminase-catalyzed incorporation of the polyamine spermidine into HIV-1 gp41
More...

AA Sequence

MMDASKELQVLHIDFLNQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKLEFSTGPNPSI      1 - 70
AKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNVKTGNHILKSEENILYLLFNP     71 - 140
WCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCCISLLTESSLKPTDRRDPV    141 - 210
LVCRAMCAMMSFEKGQGVLIGNWTGDYEGGTAPYKWTGSAPILQQYYNTKQAVCFGQCWVFAGILTTVLR    211 - 280
ALGIPARSVTGFDSAHDTERNLTVDTYVNENGEKITSMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVD    281 - 350
ATPQERSQGVFCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIGKN    351 - 420
ISTKAVGQDRRRDITYEYKYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDDVLLGNSVNF    421 - 490
TVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPV    491 - 560
IRGFIIAEIVESKEIMASEVFTSFQYPEFSIELPNTGRIGQLLVCNCIFKNTLAIPLTDVKFSLESLGIS    561 - 630
SLQTSDHGTVQPGETIQSQIKCTPIKTGPKKFIVKLSSKQVKEINAQKIVLITK                    631 - 684
//

Text Mined References (22)

PMID Year Title
26084804 2015 Transglutaminase 4 as a prostate autoantigen in male subfertility.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23974364 2013 Overexpression of transglutaminase 4 and prostate cancer progression: a potential predictor of less favourable outcomes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22362749 2012 Retinoic acid and androgen receptors combine to achieve tissue specific control of human prostatic transglutaminase expression: a novel regulatory network with broader significance.
21743959 2011 Analysis of laser-microdissected prostate cancer tissues reveals potential tumor markers.
21524313 2011 Prostate transglutaminase (TGase-4) antagonizes the anti-tumour action of MDA-7/IL-24 in prostate cancer.
20596668 2010 The prostate transglutaminase, TGase-4, coordinates with the HGFL/MSP-RON system in stimulating the migration of prostate cancer cells.
20569004 2010 Monoclonal antibodies to human transglutaminase 4.
20177144 2010 Differential alternative splicing of human transglutaminase 4 in benign prostate hyperplasia and prostate cancer.
More...