Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.16
PubTator Score 8.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
osteosarcoma 1.743 0.018
periodontitis 1.400 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.009
medulloblastoma, large-cell -1.400 0.003
primitive neuroectodermal tumor 1.100 0.001
juvenile dermatomyositis 1.033 0.000
tuberculosis -1.500 0.000
active Crohn's disease 1.514 0.034
diabetes mellitus -1.100 0.010
Breast cancer 2.600 0.027
interstitial cystitis 1.600 0.000
pediatric high grade glioma 1.100 0.008
primary Sjogren syndrome 1.200 0.003
lung carcinoma 1.400 0.000
Alzheimer's disease -1.500 0.032
Pick disease -1.500 0.001
invasive ductal carcinoma 1.100 0.032
ulcerative colitis 1.800 0.000
ovarian cancer 2.000 0.000

Synonym

Accession P48723 B2R616 Q8NE40
Symbols STCH

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
23303189 novel role of STCH in the regulation of pHi through site-specific interactions with NBCe1-B and NHE1 and subsequent modulation of membrane transporter expression.
22190034 HIV-1 gp120 is identified to have a physical interaction with heat shock protein 70kDa family, member 13 (HSPA13) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19793966 An entirely novel path is revealed toward therapeutic intervention of tauopathies by inhibition of the previously untargeted ATPase activity of Hsp70.
18793616 These results suggest that STCH has a role in cell survival via modulation of the TRAIL-mediated cell death pathway.
16087163 Observational study of gene-disease association. (HuGE Navigator)
16087163 in the Japanese population, STCH might be a new candidate for conferring susceptibility to gastric cancer
11319647 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSM      1 - 70
VSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETI     71 - 140
TVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMA    141 - 210
YGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPS    211 - 280
RKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLS    281 - 350
DKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE    351 - 420
FFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN                       421 - 471
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23303189 2013 Chaperone stress 70 protein (STCH) binds and regulates two acid/base transporters NBCe1-B and NHE1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
19793966 2009 Chemical manipulation of hsp70 ATPase activity regulates tau stability.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18793616 2008 Stomach cancer-derived del223V-226L mutation of the STCH gene causes loss of sensitization to TRAIL-mediated apoptosis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16087163 2005 A genetic variant in the gene encoding the stress70 protein chaperone family member STCH is associated with gastric cancer in the Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...