Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.19
PubTator Score 8.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.514 3.4e-02
Alzheimer's disease -1.500 3.2e-02
atypical teratoid / rhabdoid tumor -1.200 2.5e-03
Breast cancer 2.600 2.7e-02
diabetes mellitus -1.100 9.8e-03
glioblastoma 1.200 9.0e-03
interstitial cystitis 1.600 2.9e-04
invasive ductal carcinoma 1.100 3.2e-02
juvenile dermatomyositis 1.033 1.7e-09
lung carcinoma 1.400 1.1e-15
medulloblastoma, large-cell -1.400 3.4e-03
osteosarcoma 1.743 1.8e-02
ovarian cancer 2.000 1.5e-04
pediatric high grade glioma 1.100 7.9e-03
periodontitis 1.100 6.2e-17
Pick disease -1.500 5.8e-04
primary Sjogren syndrome 1.200 2.8e-03
primitive neuroectodermal tumor 1.100 1.3e-03
tuberculosis -1.500 3.7e-06
ulcerative colitis 1.800 3.2e-06

Gene RIF (8)

AA Sequence

MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSM      1 - 70
VSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETI     71 - 140
TVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMA    141 - 210
YGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPS    211 - 280
RKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLS    281 - 350
DKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE    351 - 420
FFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN                       421 - 471
//

Text Mined References (21)

PMID Year Title