Property Summary

NCBI Gene PubMed Count 95
Grant Count 104
R01 Count 48
Funding $9,103,424.7
PubMed Score 266.17
PubTator Score 453.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.338 0.002
urothelial carcinoma -1.100 0.047
psoriasis 1.800 0.001
osteosarcoma -1.308 0.003
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.200 0.006
pancreatic ductal adenocarcinoma liver m... -1.301 0.030
non-small cell lung cancer 2.402 0.000
lung cancer 3.600 0.000
interstitial cystitis -1.800 0.000
lung adenocarcinoma 1.200 0.000
lung carcinoma 1.300 0.000
ovarian cancer -1.200 0.006
pituitary cancer 1.800 0.000
Down syndrome 1.400 0.001
chronic rhinosinusitis -1.460 0.041

Synonym

Accession P48506 Q14399
Symbols GCL
GCS
GLCL
GLCLC

Gene

PANTHER Protein Class (1)

Gene RIF (82)

PMID Text
26365678 Data suggest expression of hepatocyte GCLC and GCLM can be regulated by dietary component; alpha-lipoic acid, a vitamin B complex nutrient, protects against oxidative stress/cytotoxicity induced by cadmium via restoration of GCLC and GCLM expression.
26087411 Cigarette smoke-induced hypermethylation of the GCLC promoter is related to the initiation and progression of COPD.
26059756 GCLC and GSS were expressed at higher levels in colon cancer tissue, as compared with normal mucosa.
25353619 miR-433 targets both catalytic (GCLc) and regulatory (GCLm) subunits of GCL.
24665821 H2S upregulates GCLC and GSH and inhibits IL-1beta levels, which may be what mediates the beneficial effects of H2S-rich compounds in mitigating the pathogenesis of metabolic syndrome and atherosclerosis
24068433 the CYP1A1 (rs2606345, rs4646903, rs1048943), GCLC, AGT, and AGTR1 genes was associated with pleuritis, empyema, acute respiratory distress syndrome, all PC and acute respiratory failure (ARF).
23770363 1,25 (OH) vitamin D significantly upregulated expression of GCLC and GR and lowered secretion of IL-8 and MCP-1 in high-glucose exposed U937 monocytes.
23758905 Polymorphisms in GCLC, GSTM1, GSTT1, and GSTP1 genes associated with metabolism of glutathione act on cystic fibrosis severity.
23448276 These data strongly indicate a discrepancy between the regulation of GCLC and of GGT following the oxidative stress situation due to mitochondrial uncoupling.
23443115 The Kaplan-Meier analysis shows that rs3736729 on GCLC presents a significant association with disease-free survival and overall survival.
More...

AA Sequence

MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLS      1 - 70
GEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQA     71 - 140
LCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRFSTLTRNIRHRRGEKVVINVPIFKD    141 - 210
KNTPSPFIETFTEDDEASRASKPDHIYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALS    211 - 280
AASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTI    281 - 350
DKEIYEQLLQEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI    351 - 420
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDI    421 - 490
CKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNSYLENMEVDVDTRCSILNYLK    491 - 560
LIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSG    561 - 630
SKTDSSN                                                                   631 - 637
//

Text Mined References (99)

PMID Year Title
26365678 2015 ?-Lipoic acid protects against the oxidative stress and cytotoxicity induced by cadmium in HepG2 cells through regenerating glutathione regulated by glutamate-cysteine ligase.
26087411 2016 Cigarette Smoke-Induced Hypermethylation of the GCLC Gene Is Associated With COPD.
26059756 2015 Involvement of glutathione and glutathione metabolizing enzymes in human colorectal cancer cell lines and tissues.
25353619 2015 Targeting of Gamma-Glutamyl-Cysteine Ligase by miR-433 Reduces Glutathione Biosynthesis and Promotes TGF-?-Dependent Fibrogenesis.
24665821 2014 Hydrogen sulfide upregulates glutamate-cysteine ligase catalytic subunit, glutamate-cysteine ligase modifier subunit, and glutathione and inhibits interleukin-1? secretion in monocytes exposed to high glucose levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24068433 2013 CYP1A1, GCLC, AGT, AGTR1 gene-gene interactions in community-acquired pneumonia pulmonary complications.
23770363 2013 Vitamin D upregulates glutamate cysteine ligase and glutathione reductase, and GSH formation, and decreases ROS and MCP-1 and IL-8 secretion in high-glucose exposed U937 monocytes.
23758905 2013 Genetic interaction of GSH metabolic pathway genes in cystic fibrosis.
23448276 2013 Differential regulation of ?-glutamyltransferase and glutamate cysteine ligase expression after mitochondrial uncoupling: ?-glutamyltransferase is regulated in an Nrf2- and NF?B-independent manner.
More...