Property Summary

NCBI Gene PubMed Count 30
Grant Count 96
R01 Count 24
Funding $17,162,483.02
PubMed Score 132.17
PubTator Score 27.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.600 0.005
oligodendroglioma 1.800 0.002
esophageal adenocarcinoma -1.100 0.024
cutaneous lupus erythematosus -1.500 0.002
psoriasis -2.200 0.000
osteosarcoma -2.198 0.000
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.900 0.001
medulloblastoma 1.400 0.006
medulloblastoma, large-cell 1.400 0.000
lung cancer -1.800 0.009
fibroadenoma -1.100 0.021
pediatric high grade glioma 1.100 0.005
Pick disease -1.300 0.000
ovarian cancer -1.400 0.000
pituitary cancer -1.100 0.002

Synonym

Accession P48449 B4DJZ9 D3DSN0 E9PEI9 G5E9Q9 Q8IYL6 Q9UEZ1
Symbols OSC
CTRCT44

Gene

LSS

PDB

1W6J   1W6K  

Gene RIF (9)

PMID Text
26667413 Lanosterol synthase gene polymorphisms influence both the salt sensitivity of BP and changes in circulating EO in response to a low salt diet.
25051231 There were no significant differences in OSC mRNA expression at various stages of breast cancer, or between tumor and normal mammary cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19119143 Suppression of 2,3-oxidosqualene cyclase by high fat diet contributes to liver X receptor-alpha-mediated improvement of hepatic lipid profile.
18660489 Observational study of gene-disease association. (HuGE Navigator)
15525992 two crystal structures of the human membrane protein OSC: the target protein with an inhibitor that showed cholesterol lowering in vivo opens the way for the structure-based design of new OSC inhibitors
14766201 oxidosqualene cyclase is active as a monomer

AA Sequence

MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKA      1 - 70
HTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLPAGYREEIVRYLRSVQLPDGG     71 - 140
WGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNT    141 - 210
LFPEMWLFPDWAPAHPSTLWCHCRQVYLPMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNV    211 - 280
APDELYTPHSWLLRVVYALLNLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYV    281 - 350
DGPASTAFQEHVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL    351 - 420
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVL    421 - 490
LNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETL    491 - 560
TQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWG    561 - 630
EDFESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSC    631 - 700
AISYTSYRNIFPIWALGRFSQLYPERALAGHP                                          701 - 732
//

Text Mined References (34)

PMID Year Title
26667413 2016 Lanosterol Synthase Gene Polymorphisms and Changes in Endogenous Ouabain in the Response to Low Sodium Intake.
26200341 2015 Lanosterol reverses protein aggregation in cataracts.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25051231 2014 Cholesterol synthesis inhibitor RO 48-8071 suppresses transcriptional activity of human estrogen and androgen receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21498505 2011 Human lysophosphatidylcholine acyltransferases 1 and 2 are located in lipid droplets where they catalyze the formation of phosphatidylcholine.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...