Property Summary

Ligand Count 108
NCBI Gene PubMed Count 30
PubMed Score 150.05
PubTator Score 27.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 1.3e-02
atypical teratoid / rhabdoid tumor 1.400 3.7e-04
cutaneous lupus erythematosus -1.400 7.5e-03
ependymoma 1.100 3.9e-05
esophageal adenocarcinoma -1.100 2.4e-02
fibroadenoma -1.100 2.1e-02
glioblastoma 1.900 5.4e-04
lung cancer -1.800 8.9e-03
medulloblastoma 1.400 5.8e-03
medulloblastoma, large-cell 1.400 6.5e-05
oligodendroglioma 1.200 2.0e-02
osteosarcoma -2.198 7.0e-07
ovarian cancer -1.400 7.0e-07
pediatric high grade glioma 1.100 4.7e-03
Pick disease -1.300 2.3e-04
pituitary cancer -1.100 1.7e-03
psoriasis -2.200 2.1e-04

Gene RIF (9)

AA Sequence

MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKA      1 - 70
HTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLPAGYREEIVRYLRSVQLPDGG     71 - 140
WGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNT    141 - 210
LFPEMWLFPDWAPAHPSTLWCHCRQVYLPMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNV    211 - 280
APDELYTPHSWLLRVVYALLNLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYV    281 - 350
DGPASTAFQEHVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL    351 - 420
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVL    421 - 490
LNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETL    491 - 560
TQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWG    561 - 630
EDFESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSC    631 - 700
AISYTSYRNIFPIWALGRFSQLYPERALAGHP                                          701 - 732
//

Text Mined References (34)

PMID Year Title