Property Summary

NCBI Gene PubMed Count 18
Grant Count 35
R01 Count 18
Funding $8,648,245.26
PubMed Score 26.73
PubTator Score 23.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (43)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.016
Waldenstrons macroglobulinemia 1.143 0.031
astrocytoma 3.000 0.000
ependymoma 3.200 0.002
oligodendroglioma 2.200 0.001
esophageal adenocarcinoma 1.500 0.018
glioblastoma 3.500 0.000
osteosarcoma 2.819 0.000
chronic lymphosyte leukemia -1.600 0.033
atypical teratoid / rhabdoid tumor 3.100 0.000
medulloblastoma, large-cell 1.100 0.001
primitive neuroectodermal tumor 2.000 0.000
Duchenne muscular dystrophy 1.849 0.000
limb girdle muscular dystrophy 2I 1.229 0.000
autosomal dominant Emery-Dreifuss muscul... 1.665 0.002
Becker muscular dystrophy 1.115 0.008
fascioscapulohumeral muscular dystrophy 1.014 0.000
juvenile dermatomyositis 1.130 0.000
Amyotrophic Lateral Sclerosis 1.185 0.000
acute quadriplegic myopathy 2.227 0.000
adrenocortical carcinoma -1.107 0.005
primary pancreatic ductal adenocarcinoma 1.540 0.007
intraductal papillary-mucinous adenoma (... 1.100 0.018
lung cancer -2.500 0.000
active Crohn's disease -3.081 0.017
pediatric high grade glioma 2.900 0.000
group 4 medulloblastoma -1.200 0.001
pilocytic astrocytoma 2.400 0.000
aldosterone-producing adenoma -1.296 0.048
subependymal giant cell astrocytoma 1.741 0.035
psoriasis -1.300 0.000
inflammatory breast cancer -1.400 0.000
COPD -1.700 0.002
lung carcinoma -1.800 0.000
gastric carcinoma 1.700 0.011
ductal carcinoma in situ -1.400 0.007
invasive ductal carcinoma -1.200 0.000
ovarian cancer 1.900 0.000
pituitary cancer -1.600 0.000
Down syndrome 1.100 0.019
chronic rhinosinusitis -1.286 0.013
cystic fibrosis and chronic rhinosinusit... -1.150 0.014
pancreatic cancer 1.600 0.005

Gene RIF (8)

PMID Text
25809263 Study of the role of the C-terminal residues in the structure of unbound TIS11d, the E220A mutant and the truncation mutant lacking the last two residues (D219/E220) using molecular dynamics, NMR spectroscopy, and biochemical methods
21509594 ZFP36L2 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21109922 Data suggest that the dysregulation of TIS11D function is associated with the pathogenesis of certain types of leukemia.
20506496 Multiple nanosecond timescale molecular dynamics trajectories of TIS11d wild-type and E157R/E195K mutant with different RNA sequences were performed to investigate the molecular basis for RNA binding specificities of this TZF domain.
17172869 These data suggest TIS11D as a candidate p53 target gene that may be part of the network of genes responsible for p53-dependent apoptosis.
14981510 Sequence specificity in RNA recognition is achieved by a network of intermolecular hydrogen bonds, mostly between TIS11d main-chain functional groups and the Watson-Crick edges of the bases
14604009 polymorphisms sequenced in genomic DNA encoding the TTP protein (ZFP36) and those of its two known mammalian relatives, ZFP36L1 and ZFP36L2, from 72 to 92 anonymous human subjects from various geographical and ethnic backgrounds

AA Sequence

MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPS      1 - 70
PGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQ     71 - 140
QKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGP    141 - 210
RCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLL    211 - 280
DSPTSRTPPPPSCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPC    281 - 350
AACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG    351 - 420
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLS    421 - 490
ISDD                                                                      491 - 494
//

Text Mined References (25)

PMID Year Title
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
25809263 2015 Probing the structural and dynamical effects of the charged residues of the TZF domain of TIS11d.
25106868 2014 ZFP36L1 and ZFP36L2 control LDLR mRNA stability via the ERK-RSK pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
More...