Property Summary

NCBI Gene PubMed Count 19
PubMed Score 30.55
PubTator Score 23.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 8.8e-26
Duchenne muscular dystrophy 601 1.1e-08
juvenile dermatomyositis 1187 1.9e-08
Breast cancer 3578 2.7e-08
acute quadriplegic myopathy 1158 7.2e-08
lung cancer 4740 2.4e-06
atypical teratoid / rhabdoid tumor 5112 4.2e-06
psoriasis 6694 5.4e-06
Astrocytoma, Pilocytic 3081 9.2e-06
Amyotrophic lateral sclerosis 451 4.7e-05
osteosarcoma 7950 6.1e-05
ovarian cancer 8520 1.1e-04
primitive neuroectodermal tumor 3035 1.1e-04
limb girdle muscular dystrophy 2A 213 1.3e-04
invasive ductal carcinoma 2951 1.8e-04
adrenocortical carcinoma 1428 1.9e-04
glioblastoma 5792 2.0e-04
fascioscapulohumeral muscular dystrophy 100 4.5e-04
group 4 medulloblastoma 1855 6.2e-04
medulloblastoma, large-cell 6241 6.3e-04
oligodendroglioma 2850 6.7e-04
astrocytic glioma 2597 7.6e-04
ependymoma 4679 1.7e-03
COPD 118 1.7e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 2.3e-03
ductal carcinoma in situ 1745 7.2e-03
Becker muscular dystrophy 191 7.9e-03
gastric carcinoma 807 1.1e-02
pituitary cancer 1972 1.1e-02
subependymal giant cell astrocytoma 2287 1.1e-02
chronic rhinosinusitis 512 1.3e-02
cystic fibrosis and chronic rhinosinusitis 214 1.4e-02
Rheumatoid arthritis 1191 1.6e-02
active Crohn's disease 922 1.7e-02
esophageal adenocarcinoma 737 1.8e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 1.8e-02
Down syndrome 499 1.9e-02
pancreatic cancer 2398 2.7e-02
Waldenstrons macroglobulinemia 765 3.1e-02
adult high grade glioma 3801 3.3e-02
chronic lymphosyte leukemia 204 3.3e-02
primary pancreatic ductal adenocarcinoma 1109 4.5e-02
aldosterone-producing adenoma 665 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (43)

Disease log2 FC p
active Crohn's disease -3.081 1.7e-02
acute quadriplegic myopathy 1.593 7.2e-08
adrenocortical carcinoma -1.087 1.9e-04
adult high grade glioma 1.600 3.3e-02
aldosterone-producing adenoma -1.296 4.8e-02
Amyotrophic lateral sclerosis 1.185 4.7e-05
astrocytic glioma 2.300 7.6e-04
Astrocytoma, Pilocytic 2.500 9.2e-06
atypical teratoid / rhabdoid tumor 3.100 4.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.132 2.3e-03
Becker muscular dystrophy 1.115 7.9e-03
Breast cancer -1.300 2.7e-08
chronic lymphosyte leukemia -1.600 3.3e-02
chronic rhinosinusitis -1.286 1.3e-02
COPD -1.700 1.7e-03
cystic fibrosis and chronic rhinosinusit... -1.150 1.4e-02
Down syndrome 1.100 1.9e-02
Duchenne muscular dystrophy 1.849 1.1e-08
ductal carcinoma in situ -1.400 7.2e-03
ependymoma 3.200 1.7e-03
esophageal adenocarcinoma 1.500 1.8e-02
fascioscapulohumeral muscular dystrophy 1.014 4.5e-04
gastric carcinoma 1.700 1.1e-02
glioblastoma 1.900 2.0e-04
group 4 medulloblastoma -1.200 6.2e-04
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
invasive ductal carcinoma -1.200 1.8e-04
juvenile dermatomyositis 1.130 1.9e-08
limb girdle muscular dystrophy 2A 1.133 1.3e-04
lung cancer -2.500 2.4e-06
lung carcinoma -1.800 8.8e-26
medulloblastoma, large-cell 1.100 6.3e-04
oligodendroglioma 2.200 6.7e-04
osteosarcoma 2.819 6.1e-05
ovarian cancer -1.700 1.1e-04
pancreatic cancer 1.100 2.7e-02
pituitary cancer -1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 1.310 4.5e-02
primitive neuroectodermal tumor 2.000 1.1e-04
psoriasis -1.300 5.4e-06
Rheumatoid arthritis 1.800 1.6e-02
subependymal giant cell astrocytoma 1.365 1.1e-02
Waldenstrons macroglobulinemia 1.143 3.1e-02

Gene RIF (9)

AA Sequence

MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPS      1 - 70
PGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQ     71 - 140
QKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGP    141 - 210
RCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLL    211 - 280
DSPTSRTPPPPSCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPC    281 - 350
AACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG    351 - 420
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLS    421 - 490
ISDD                                                                      491 - 494
//

Text Mined References (26)

PMID Year Title