Property Summary

Ligand Count 1
NCBI Gene PubMed Count 36
PubMed Score 42.19
PubTator Score 54.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.600 1.4e-04
atypical teratoid / rhabdoid tumor 1.400 1.4e-08
glioblastoma 1.400 1.3e-03
group 3 medulloblastoma 1.300 3.0e-05
medulloblastoma, large-cell 1.500 2.1e-06
Multiple myeloma 1.119 7.0e-03
oligodendroglioma 1.300 1.0e-02
osteosarcoma -1.176 9.9e-06
ovarian cancer -1.200 3.6e-04
Waldenstrons macroglobulinemia 1.133 2.6e-03

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLS      1 - 70
FLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVE     71 - 140
RYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVEN    141 - 210
GETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGH    211 - 280
AKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELI    281 - 350
RRGLAYVCHQRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV    351 - 420
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLH    421 - 490
YAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDV    491 - 560
LNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGFKRL    561 - 630
AWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKN    631 - 700
PEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKE    701 - 770
DPGKV                                                                     771 - 775
//

Text Mined References (44)

PMID Year Title