Property Summary

NCBI Gene PubMed Count 32
Grant Count 33
R01 Count 27
Funding $3,768,492.54
PubMed Score 39.47
PubTator Score 54.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.133 0.003
Multiple myeloma 1.119 0.007
oligodendroglioma 1.300 0.010
osteosarcoma -1.176 0.000
sonic hedgehog group medulloblastoma 1.700 0.000
astrocytoma 1.600 0.000
glioblastoma 1.400 0.001
atypical teratoid/rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.500 0.000
ovarian cancer 1.600 0.000

Gene RIF (7)

PMID Text
26869582 Pathological mutations mapping in the N-terminal domain alter the domain structure, and decrease catalytic activity and stability of GlnRS, whereas missense mutations in the catalytic domain induce misfolding of the enzyme.
25471517 Data indicate compound heterozygous mutations [c.169T>C (p.Tyr57His) and c.1485dup (p.Lys496*)] in QARS, which encodes glutaminyl-tRNA synthetase, in two siblings with early-onset epileptic encephalopathy (EOEE).
25288775 interactions between the N-terminal domains of ArgRS and AIMP1 are important for the catalytic and noncatalytic activities of ArgRS and for the assembly of the higher-order MSC protein complex with ArgRS-GlnRS-AIMP1
25010285 Interaction of HIV-1 Gag with glutaminyl-tRNA synthetase (QARS) is identified in a series of six affinity purification/mass spectrometry screens
24656866 results highlight the importance of QARS during brain development and that epilepsy due to impairment of QARS activity is unusually severe in comparison to other aminoacyl-tRNA synthetase disorders
24003230 Data indicate that glutaminyl-tRNA synthetase splice variant GlnRSDeltaiABD was present in exosomes extruded from Jurkat cells and functional in protein synthesis.
22190034 Interaction of HIV-1 Gag with glutaminyl-tRNA synthetase (QARS) is identified in a series of six affinity purification/mass spectrometry screens

AA Sequence

MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLS      1 - 70
FLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVE     71 - 140
RYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVEN    141 - 210
GETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGH    211 - 280
AKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELI    281 - 350
RRGLAYVCHQRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV    351 - 420
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLH    421 - 490
YAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDV    491 - 560
LNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGFKRL    561 - 630
AWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKN    631 - 700
PEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKE    701 - 770
DPGKV                                                                     771 - 775
//

Text Mined References (40)

PMID Year Title
26869582 2016 The crystal structure of human GlnRS provides basis for the development of neurological disorders.
25471517 2015 Mutations in the glutaminyl-tRNA synthetase gene cause early-onset epileptic encephalopathy.
25416956 2014 A proteome-scale map of the human interactome network.
25288775 2014 Structure of the ArgRS-GlnRS-AIMP1 complex and its implications for mammalian translation.
24656866 2014 Mutations in QARS, encoding glutaminyl-tRNA synthetase, cause progressive microcephaly, cerebral-cerebellar atrophy, and intractable seizures.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24003230 2013 Regulated capture by exosomes of mRNAs for cytoplasmic tRNA synthetases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22659028 2012 Genome-scale analysis of human mRNA 5' coding sequences based on expressed sequence tag (EST) database.
More...