Property Summary

NCBI Gene PubMed Count 25
PubMed Score 54.29
PubTator Score 30.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Iw 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.7
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 3.596 1.8
Disease Target Count Z-score Confidence
Thyroid adenoma 10 3.617 1.8
Nodular Goiter 6 3.331 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
cystic fibrosis 1.291 8.4e-06
ependymoma 1.200 2.2e-05
Gaucher disease type 3 1.100 5.8e-03
glioblastoma 1.200 1.3e-04
group 3 medulloblastoma 1.700 1.9e-03
lung adenocarcinoma 1.238 3.3e-07
Multiple myeloma 1.404 8.6e-04
non-small cell lung cancer 1.004 1.5e-14
osteosarcoma 1.448 4.6e-03
ovarian cancer 1.500 7.7e-04
pancreatic cancer 1.300 2.0e-02
pancreatic carcinoma 1.300 2.0e-02

Gene RIF (8)

AA Sequence

MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHN      1 - 70
WFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKD     71 - 140
AGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWG    141 - 210
GYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIH    211 - 280
AFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVS    281 - 350
EHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI    351 - 420
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVL    421 - 490
SARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMA    491 - 560
STEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREG    561 - 630
SPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNR    631 - 700
GLSRT                                                                     701 - 705
//

Text Mined References (33)

PMID Year Title