Property Summary

NCBI Gene PubMed Count 23
Grant Count 32
R01 Count 22
Funding $3,683,504.86
PubMed Score 50.40
PubTator Score 30.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.300 0.020
Multiple myeloma 1.404 0.001
osteosarcoma 1.448 0.005
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 1.200 0.000
group 3 medulloblastoma 1.700 0.002
cystic fibrosis 1.291 0.000
non-small cell lung cancer 1.004 0.000
pancreatic carcinoma 1.300 0.020
lung adenocarcinoma 1.238 0.000
ovarian cancer 1.500 0.001
Gaucher disease type 3 1.100 0.006

Gene RIF (6)

PMID Text
25029371 Consensus sites containing large hydrophobic and negatively charged middle residues are frequently skipped by STT3A during protein translation.
23842455 Results show homozygous mutation in STT3A and in STT3B causes congenital disorders of glycosylation.
22157935 DDIT3, STT3A, ARG2 and FAM129A immunohistochemistry does not appear to be useful in the diagnosis of thyroid follicular neoplasias, as they do not reliably distinguish follicular thyroid carcinoma from follicular thyroid adenoma.
21520112 Gene-expression data suggest a difference in expression between STT3A, Clorf24, and TFF3 in FAs versus carcinomas that may be detected from an FNA sample. Findings must be validated from preoperative FNAs in larger numbers
19167329 The STT3A OST isoform is primarily responsible for cotranslational glycosylation of the nascent polypeptide as it enters the lumen of the endoplasmic reticulum.
18187620 Knockdown of STT3, subunit of the oligosaccharyltransferase complex, homolog A (STT3A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHN      1 - 70
WFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKD     71 - 140
AGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWG    141 - 210
GYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIH    211 - 280
AFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVS    281 - 350
EHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI    351 - 420
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVL    421 - 490
SARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMA    491 - 560
STEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREG    561 - 630
SPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNR    631 - 700
GLSRT                                                                     701 - 705
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25792706 2015 Reduced expression of the oligosaccharyltransferase exacerbates protein hypoglycosylation in cells lacking the fully assembled oligosaccharide donor.
25579050 2015 Evidence for schizophrenia susceptibility alleles in the Indian population: An association of neurodevelopmental genes in case-control and familial samples.
25460543 2015 Cotranslational and posttranslocational N-glycosylation of proteins in the endoplasmic reticulum.
25135935 2014 Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
25029371 2014 The middle X residue influences cotranslational N-glycosylation consensus site skipping.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23842455 2013 Mutations in STT3A and STT3B cause two congenital disorders of glycosylation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...