Property Summary

NCBI Gene PubMed Count 339
Grant Count 224
R01 Count 157
Funding $23,846,884.58
PubMed Score 335.17
PubTator Score 708.57

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

3MHR   3KYS   4RE1   2LTV   2LTW   1JMQ   1K5R   1K9Q   1K9R   2LAW   2LAX   2LAY   4REX  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743488 summary 0 / 0 / 0 Broad Institute Identification of Selective YAP1 Small Molecule Inhibitors Inhibitor Probe Project

Gene RIF (297)

PMID Text
26986510 the Cdc42/Nwasp/stress fibers/YAP signal pathway may potentially play an important role in regulating podocyte apoptosis. Maintaining necessary Cdc42 would be one potent way to prevent proteinuria kidney diseases.
26967905 treatment with Verteporfin, an inhibitor of YAP transcriptional activity, partially rescued the 3D spheroid defects of Nek8-invalidated cells and the abnormalities of NEK8-overexpressing zebrafish embryos
26944315 Nuclear accumulation of YAP could promote the survival of senescent cells by increasing survivin expression.
26923924 we demonstrate that NF2 negatively controls the invasiveness of Glioblastoma multiforme through YAP-dependent induction of CYR61/CCN1 and miR-296-3p.
26876920 A direct interaction of ZEB1 with the Hippo pathway effector YAP, in which ZEB1 switches its function to a transcriptional co-activator of a 'common ZEB1/YAP target gene set', links two pathways with similar cancer promoting effects.
26791271 This study suggests that ROCK/YAP/Egr-1 signaling regulates tissue factor expression after stimulation with lipopolysaccharide in endothelial cells.
26759237 RASSF1 acts to restrict EMT and invasion by indirectly controlling YAP nuclear shuttling.
26691213 YAP physically interacts with mutant p53 proteins in breast cancer cells and potentiates their pro-proliferative transcriptional activity.
26678338 MYC-driven change in mitochondrial dynamics limits YAP/TAZ function in mammary epithelial cells and breast neoplasms.
26671411 The SRF-IL6 axis is the critical mediator of YAP-induced stemness in mammary epithelial cells and breast cancer.
More...

AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFN      1 - 70
AVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPG     71 - 140
TLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQM    141 - 210
NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVK    211 - 280
QPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRS    281 - 350
QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV    351 - 420
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVL    421 - 490
AATKLDKESFLTWL                                                            491 - 504
//

Text Mined References (357)

PMID Year Title
26986510 2016 Cdc42 deficiency induces podocyte apoptosis by inhibiting the Nwasp/stress fibers/YAP pathway.
26967905 2016 Novel NEK8 Mutations Cause Severe Syndromic Renal Cystic Dysplasia through YAP Dysregulation.
26944315 2016 Nuclear accumulation of Yes-Associated Protein (YAP) maintains the survival of doxorubicin-induced senescent cells by promoting survivin expression.
26923924 2016 Neurofibromatosis 2 (NF2) controls the invasiveness of glioblastoma through YAP-dependent expression of CYR61/CCN1 and miR-296-3p.
26876920 2016 ZEB1 turns into a transcriptional activator by interacting with YAP1 in aggressive cancer types.
26791271 2016 Yes-associated protein (YAP) signaling regulates lipopolysaccharide-induced tissue factor expression in human endothelial cells.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26691213 2016 YAP enhances the pro-proliferative transcriptional activity of mutant p53 proteins.
26678338 2015 A MYC-Driven Change in Mitochondrial Dynamics Limits YAP/TAZ Function in Mammary Epithelial Cells and Breast Cancer.
26671411 2015 A basal-like breast cancer-specific role for SRF-IL6 in YAP-induced cancer stemness.
More...