Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 8
Funding $1,093,249.33
PubMed Score 36.06
PubTator Score 62.74

Knowledge Summary

Patent (7,986)

TINX Plot

Expression

Gene RIF (7)

PMID Text
24069330 Gpr3 stimulates Abeta production via interactions with APP and beta-arrestin2.
23732663 GPR3 is a key factor in the regulation of the nervous system and follicle development.[review]
20158988 Mutations in GPR3 are not a common cause of premature ovarian failure in Chinese women.
17953967 We conclude that perturbations in GPR3 are not a common explanation for POF in this population.
17953967 Observational study of genotype prevalence. (HuGE Navigator)
15591206 GPR3 is expressed in the ovary and testes, and is necessary for the regulation of meiosis in mouse.
12649592 control of gene expression in vascular endothelial cells in the presence of fluid shear stress and classifies it as a sphingosine 1-phosphate receptor.

AA Sequence

MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPA      1 - 70
FRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYN     71 - 140
ALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIML    141 - 210
QLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTY    211 - 280
LTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV                        281 - 330
//

Text Mined References (18)

PMID Year Title
24069330 2013 Gpr3 stimulates A? production via interactions with APP and ?-arrestin2.
23732663 2013 [G protein-coupled receptor 3: a key factor in the regulation of the nervous system and follicle development].
20158988 2010 GPR3 may not be a potential candidate gene for premature ovarian failure.
19286662 2009 Lipid G protein-coupled receptor ligand identification using beta-arrestin PathHunter assay.
19213921 2009 The orphan G protein-coupled receptor 3 modulates amyloid-beta peptide generation in neurons.
17953967 2008 Oocyte-specific G-protein-coupled receptor 3 (GPR3): no perturbations found in 82 women with premature ovarian failure (first report).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15591206 2004 The Gs-linked receptor GPR3 maintains meiotic arrest in mammalian oocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...