Property Summary

NCBI Gene PubMed Count 245
PubMed Score 1272.53
PubTator Score 625.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
malignant mesothelioma 3232 4.7e-09
non-small cell lung cancer 2890 2.4e-08
lung cancer 4740 1.9e-07

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -5.800 1.9e-07
malignant mesothelioma 6.500 4.7e-09
non-small cell lung cancer -1.151 2.4e-08

Gene RIF (215)

AA Sequence

MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM      1 - 70
TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM     71 - 140
GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ    141 - 210
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA    211 - 280
SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL    281 - 350
NSSGSDYGTMSCSTLLYGRTW                                                     351 - 371
//

Text Mined References (248)

PMID Year Title