Tbio | Homeobox protein Nkx-2.1 |
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity).
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription. [provided by RefSeq, Feb 2014]
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription. [provided by RefSeq, Feb 2014]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 1.96896208789643E-11 |
malignant mesothelioma | 3163 | 4.72422679868913E-9 |
lung cancer | 4473 | 2.3978715545726E-8 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Congenital hypothyroidism | 20 | 0.0 | 4.0 |
Disease | Target Count |
---|---|
Brain-lung-thyroid syndrome | 1 |
Chorea, Benign Hereditary | 3 |
Thyroid Cancer, Nonmedullary, 1 | 2 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 6.500 | 0.000 |
non-small cell lung cancer | -2.534 | 0.000 |
lung cancer | -7.900 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA Inparanoid |
C. elegans | EggNOG Inparanoid |
PMID | Text |
---|---|
26556242 | EGFR knockdown led to upregulation of NKX2-1, suggesting a negative feedback loop. combined knockdown of NKX2-1 and EGFR in NCI-H1819 lung cancer cells reduced cell proliferation more than knockdown of either alone. |
26456962 | Suggest TTF-1 is a reliable marker in non-small cell lung carcinoma and can be used in differential diagnosis. |
26356687 | Mutations of TTF1 is associated with risk of Papillary Thyroid Cancer in Chinese. Patients with Multiplendular goiter and no metastasis are more likely to suffer PTC. C/T variant of TTF1 had a high correlation with PTC in the overall population. |
26337230 | Preoperative serum miR-365 and TTF-1 mRNA levels may be effective indicators of tumor aggressiveness in human NSCLC. miR-365 and its target gene TTF-1 appear to be synergistic risk factors for the reduction in overall survival of patients with NSCLC. |
26316052 | In adenocarcinomas from extrahepatic biliary tract, there was no correlation between TTF-1 expression and the clinicopathological characteristics. |
26247534 | Letter/Case Report: Merkel cell carcinoma with diffuse TTF-1 expression. |
26206751 | genetic susceptibility to thyroid cancer seems likely to be associated with the risk allele at rs944289 |
26045746 | Aberrant expression of mir-365/TTF-1 may be involved in the tumor development in patients with non-small cell lung carcinoma. |
25944390 | Different staining patterns can be seen with CK5/6 and p63; however, if they are used together with TTF-1 they can be used in subtyping lung neoplasms. |
25934249 | Case Report: uprasellar chordoid glioma expression thyroid transcription factor 1. |
More... |
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM 1 - 70 TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM 71 - 140 GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ 141 - 210 NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA 211 - 280 SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL 281 - 350 NSSGSDYGTMSCSTLLYGRTW 351 - 371 //
PMID | Year | Title |
---|---|---|
26723978 | 2016 | Functional characterization of two novel mutations in TTF-1/NKX2.1 homeodomain in patients with benign hereditary chorea. |
26556242 | 2015 | Integrative Genomics Implicates EGFR as a Downstream Mediator in NKX2-1 Amplified Non-Small Cell Lung Cancer. |
26456962 | 2015 | Expression of p63, TTF-1 and Maspin in Non-Small Cell Lung Carcinoma and Their Effect on the Prognosis and Differential Diagnosis. |
26356687 | 2015 | Replication and Meta-Analysis of Common Gene Mutations in TTF1 and TTF2 with Papillary Thyroid Cancer. |
26337230 | 2015 | Serum microRNA-365 in combination with its target gene TTF-1 as a non-invasive prognostic marker for non-small cell lung cancer. |
26316052 | 2016 | Thyroid Transcription Factor-1 Expression in Adenocarcinomas of the Bile Duct. |
26247534 | 2015 | Letter to the Editor: Diffuse TTF-1 expression in a case of Merkel cell carcinoma. |
26206751 | 2015 | TITF1 and TITF2 loci variants indicate significant associations with thyroid cancer. |
26045746 | 2015 | Associations of deregulation of mir-365 and its target mRNA TTF-1 and survival in patients with NSCLC. |
25944390 | 2015 | The Value of Cytokeratin 5/6, p63 and Thyroid Transcription Factor-1 in Adenocarcinoma, Squamous Cell Carcinoma and Non-Small-Cell Lung Cancer of the Lung. |
More... |