Property Summary

NCBI Gene PubMed Count 233
Grant Count 235
R01 Count 118
Funding $39,259,710.09
PubMed Score 1210.58
PubTator Score 625.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 6.500 0.000
non-small cell lung cancer -2.534 0.000
lung cancer -7.900 0.000

Synonym

Accession P43699 D3DSA3 O14954 O14955 Q7KZF6 Q9BRJ8
Symbols BCH
BHC
NK-2
TEBP
TTF1
NKX2A
NMTC1
T/EBP
TITF1
TTF-1
NKX2.1

Gene

Gene RIF (203)

PMID Text
26556242 EGFR knockdown led to upregulation of NKX2-1, suggesting a negative feedback loop. combined knockdown of NKX2-1 and EGFR in NCI-H1819 lung cancer cells reduced cell proliferation more than knockdown of either alone.
26456962 Suggest TTF-1 is a reliable marker in non-small cell lung carcinoma and can be used in differential diagnosis.
26356687 Mutations of TTF1 is associated with risk of Papillary Thyroid Cancer in Chinese. Patients with Multiplendular goiter and no metastasis are more likely to suffer PTC. C/T variant of TTF1 had a high correlation with PTC in the overall population.
26337230 Preoperative serum miR-365 and TTF-1 mRNA levels may be effective indicators of tumor aggressiveness in human NSCLC. miR-365 and its target gene TTF-1 appear to be synergistic risk factors for the reduction in overall survival of patients with NSCLC.
26316052 In adenocarcinomas from extrahepatic biliary tract, there was no correlation between TTF-1 expression and the clinicopathological characteristics.
26247534 Letter/Case Report: Merkel cell carcinoma with diffuse TTF-1 expression.
26206751 genetic susceptibility to thyroid cancer seems likely to be associated with the risk allele at rs944289
26045746 Aberrant expression of mir-365/TTF-1 may be involved in the tumor development in patients with non-small cell lung carcinoma.
25944390 Different staining patterns can be seen with CK5/6 and p63; however, if they are used together with TTF-1 they can be used in subtyping lung neoplasms.
25934249 Case Report: uprasellar chordoid glioma expression thyroid transcription factor 1.
More...

AA Sequence

MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM      1 - 70
TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM     71 - 140
GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ    141 - 210
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA    211 - 280
SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL    281 - 350
NSSGSDYGTMSCSTLLYGRTW                                                     351 - 371
//

Text Mined References (236)

PMID Year Title
26723978 2016 Functional characterization of two novel mutations in TTF-1/NKX2.1 homeodomain in patients with benign hereditary chorea.
26556242 2015 Integrative Genomics Implicates EGFR as a Downstream Mediator in NKX2-1 Amplified Non-Small Cell Lung Cancer.
26456962 2015 Expression of p63, TTF-1 and Maspin in Non-Small Cell Lung Carcinoma and Their Effect on the Prognosis and Differential Diagnosis.
26356687 2015 Replication and Meta-Analysis of Common Gene Mutations in TTF1 and TTF2 with Papillary Thyroid Cancer.
26337230 2015 Serum microRNA-365 in combination with its target gene TTF-1 as a non-invasive prognostic marker for non-small cell lung cancer.
26316052 2016 Thyroid Transcription Factor-1 Expression in Adenocarcinomas of the Bile Duct.
26247534 2015 Letter to the Editor: Diffuse TTF-1 expression in a case of Merkel cell carcinoma.
26206751 2015 TITF1 and TITF2 loci variants indicate significant associations with thyroid cancer.
26045746 2015 Associations of deregulation of mir-365 and its target mRNA TTF-1 and survival in patients with NSCLC.
25944390 2015 The Value of Cytokeratin 5/6, p63 and Thyroid Transcription Factor-1 in Adenocarcinoma, Squamous Cell Carcinoma and Non-Small-Cell Lung Cancer of the Lung.
More...