Property Summary

NCBI Gene PubMed Count 36
Grant Count 6
Funding $592,682
PubMed Score 33.28
PubTator Score 51.98

Knowledge Summary

Patent (5,909)

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
ependymoma 1.400 0.000
glioblastoma 1.700 0.000
primitive neuroectodermal tumor 1.100 0.004
juvenile dermatomyositis 1.041 0.000
adrenocortical carcinoma -1.315 0.002
lung cancer 1.300 0.000
sarcoidosis 1.200 0.004
breast carcinoma -1.100 0.000
Breast cancer 2.500 0.041
pediatric high grade glioma 1.700 0.001
pilocytic astrocytoma 2.200 0.000
sonic hedgehog group medulloblastoma 1.500 0.004
subependymal giant cell astrocytoma 3.273 0.007
ovarian cancer 2.200 0.000
Gaucher disease type 3 -1.600 0.045

Gene RIF (20)

PMID Text
25849892 These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.
25589345 LPAR6 has a role in tumorigenicity of hepatocellular carcinoma
25119526 Missense mutations in LPAR6 reveal abnormal phospholipid signaling pathways leading to hypotrichosis.
23773027 We have identified a novel deletion mutation in LPAR6, which was responsible for autosomal woolly hair syndrome with hypotrichosis in a consanguineous Chinese family.
23084965 LPA2 and LPA6 receptor subtypes are predominant in both HPAECs and HMVECs
22621192 homozygous loss of the entire LPAR6 gene in a Turkish family with hypotrichosis and woolly hair
22531990 These findings extend the spectrum of known LPAR6 mutations and suggest a founder effect of the p.G146R mutation in the Pakistani population
22385360 study extends the spectrum of mutations in LPAR6/P2RY5 gene and underscores those mutations in LPAR6/P2RY5 and LIPH result in similar phenotypes
21426374 Mutations identified in the present study extend the body of evidence implicating LPAR6 and LIPH genes in pathogenesis of human hereditary hair loss.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTL      1 - 70
PFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGV     71 - 140
WLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKT    141 - 210
LTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIA    211 - 280
VSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA          281 - 344
//

Text Mined References (37)

PMID Year Title
25849892 2015 Diverse effects of LPA4, LPA5 and LPA6 on the activation of tumor progression in pancreatic cancer cells.
25589345 2015 Lysophosphatidic acid receptor LPAR6 supports the tumorigenicity of hepatocellular carcinoma.
25119526 2014 In silico analysis of missense mutations in LPAR6 reveals abnormal phospholipid signaling pathway leading to hypotrichosis.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23773027 2013 A novel deletion mutation in the LPAR6 gene underlies autosomal recessive woolly hair with hypotrichosis.
23084965 2013 Comparing the differential effects of LPA on the barrier function of human pulmonary endothelial cells.
22621192 2012 Identification of an Alu-mediated 12.2-kb deletion of the complete LPAR6 (P2RY5) gene in a Turkish family with hypotrichosis and woolly hair.
22531990 A novel mutation in lysophosphatidic acid receptor 6 gene in autosomal recessive hypotrichosis and evidence for a founder effect.
22385360 2013 Mutations in LPAR6/P2RY5 and LIPH are associated with woolly hair and/or hypotrichosis.
21426374 2011 Mutations in the LPAR6 and LIPH genes underlie autosomal recessive hypotrichosis/woolly hair in 17 consanguineous families from Pakistan.
More...