Property Summary

NCBI Gene PubMed Count 36
PubMed Score 33.28
PubTator Score 51.98

Knowledge Summary

Patent (5,909)

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.91361147996377E-10
pilocytic astrocytoma 3086 1.5844284240881E-7
malignant mesothelioma 3163 2.17071670450168E-7
ependymoma 2514 4.57793737541283E-6
glioblastoma 5572 7.3580226964617E-6
ovarian cancer 8492 4.91279910435539E-5
breast carcinoma 1614 1.56342998696576E-4
lung cancer 4473 1.63664906029906E-4
pediatric high grade glioma 2712 6.69475427040081E-4
adrenocortical carcinoma 1427 0.00240972477715978
primitive neuroectodermal tumor 3031 0.00367780509082702
sonic hedgehog group medulloblastoma 1482 0.00394150644594996
sarcoidosis 368 0.00406758175253051
subependymal giant cell astrocytoma 2287 0.00669257484739941
Breast cancer 3099 0.0407865954873552
Gaucher disease type 3 76 0.045119856668668
Disease Target Count Z-score Confidence
Hypotrichosis 29 5.871 2.9
Disease Target Count Z-score Confidence
Monilethrix 17 3.334 1.7

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
ependymoma 1.400 0.000
glioblastoma 1.700 0.000
primitive neuroectodermal tumor 1.100 0.004
juvenile dermatomyositis 1.041 0.000
adrenocortical carcinoma -1.315 0.002
lung cancer 1.300 0.000
sarcoidosis 1.200 0.004
breast carcinoma -1.100 0.000
Breast cancer 2.500 0.041
pediatric high grade glioma 1.700 0.001
pilocytic astrocytoma 2.200 0.000
sonic hedgehog group medulloblastoma 1.500 0.004
subependymal giant cell astrocytoma 3.273 0.007
ovarian cancer 2.200 0.000
Gaucher disease type 3 -1.600 0.045

Synonym

Accession P43657 A4FTW9 B3KVF2 F2YGU4 O15133 Q3KPF5 Q53FA0 Q5VW44 Q7Z3S0 Q7Z3S6 LPA receptor 6
Symbols LAH3
P2Y5
ARWH1
HYPT8
P2RY5

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gene RIF (20)

PMID Text
25849892 These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.
25589345 LPAR6 has a role in tumorigenicity of hepatocellular carcinoma
25119526 Missense mutations in LPAR6 reveal abnormal phospholipid signaling pathways leading to hypotrichosis.
23773027 We have identified a novel deletion mutation in LPAR6, which was responsible for autosomal woolly hair syndrome with hypotrichosis in a consanguineous Chinese family.
23084965 LPA2 and LPA6 receptor subtypes are predominant in both HPAECs and HMVECs
22621192 homozygous loss of the entire LPAR6 gene in a Turkish family with hypotrichosis and woolly hair
22531990 These findings extend the spectrum of known LPAR6 mutations and suggest a founder effect of the p.G146R mutation in the Pakistani population
22385360 study extends the spectrum of mutations in LPAR6/P2RY5 gene and underscores those mutations in LPAR6/P2RY5 and LIPH result in similar phenotypes
21426374 Mutations identified in the present study extend the body of evidence implicating LPAR6 and LIPH genes in pathogenesis of human hereditary hair loss.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTL      1 - 70
PFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGV     71 - 140
WLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKT    141 - 210
LTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIA    211 - 280
VSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA          281 - 344
//

Text Mined References (37)

PMID Year Title
25849892 2015 Diverse effects of LPA4, LPA5 and LPA6 on the activation of tumor progression in pancreatic cancer cells.
25589345 2015 Lysophosphatidic acid receptor LPAR6 supports the tumorigenicity of hepatocellular carcinoma.
25119526 2014 In silico analysis of missense mutations in LPAR6 reveals abnormal phospholipid signaling pathway leading to hypotrichosis.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23773027 2013 A novel deletion mutation in the LPAR6 gene underlies autosomal recessive woolly hair with hypotrichosis.
23084965 2013 Comparing the differential effects of LPA on the barrier function of human pulmonary endothelial cells.
22621192 2012 Identification of an Alu-mediated 12.2-kb deletion of the complete LPAR6 (P2RY5) gene in a Turkish family with hypotrichosis and woolly hair.
22531990 A novel mutation in lysophosphatidic acid receptor 6 gene in autosomal recessive hypotrichosis and evidence for a founder effect.
22385360 2013 Mutations in LPAR6/P2RY5 and LIPH are associated with woolly hair and/or hypotrichosis.
21426374 2011 Mutations in the LPAR6 and LIPH genes underlie autosomal recessive hypotrichosis/woolly hair in 17 consanguineous families from Pakistan.
More...