Property Summary

NCBI Gene PubMed Count 155
Grant Count 24
R01 Count 4
Funding $3,234,722.97
PubMed Score 140.41
PubTator Score 171.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.221 1.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.001

Gene RIF (137)

PMID Text
26542067 gene polymorphism is associated with Crohn's disease in Spanish patients
26542066 KIR2DL2/2DS2-C1C1 genotype is associated with type 1 diabetes in Saudi children
26430804 Single Nucleotide Polymorphism in KIR2DL3 gene is associated with Asthma and Atopic Dermatitis.
26423800 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26372271 The authors have identified a deleterious effect of the KIR2DL3-HLA-C1 receptor-ligand combination on HIV clinical outcomes in a Thai cohort.
26255774 study compared KIR gene repertoire of HIV-1 positive with exposed uninfected (EU)) infants to elucidate its association with transmission; results revealed presence of significantly high frequencies of activating gene KIR 2DS5 and inhibitory gene KIR 2DL3 in EU infants as compared to HIV-1 positive infants
26031759 genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes.
25484131 CD4(+) CD28(-) cells exhibited increased KIR2DS2, reduced KIR2DL3 and increased DAP12 expression in HD-ESRD compared with NDD-CKD patients.
25359276 KIR2DL3-positive NK cells were more sensitive to changes in the peptide content of MHC class I than KIR2DL2-positive NK cells.
25329633 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
More...

AA Sequence

MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQ    211 - 280
EPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP             281 - 341
//

Text Mined References (155)

PMID Year Title
26542067 2016 Significant association of the KIR2DL3/HLA-C1 genotype with susceptibility to Crohn's disease.
26542066 2016 Investigation of activating and inhibitory killer cell immunoglobulin-like receptors and their putative ligands in type 1 diabetes (T1D).
26430804 2015 Imputation of KIR Types from SNP Variation Data.
26423800 2015 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26372271 2015 The effect of KIR2D-HLA-C receptor-ligand interactions on clinical outcome in a HIV-1 CRF01_AE-infected Thai population.
26255774 2016 Diversity in KIR gene repertoire in HIV-1 exposed infected and uninfected infants: A study from India.
26031759 2016 Killer immunoglobulin receptor genes and their HLA-C ligand are associated with Type 1 diabetes in an Eastern Indian population.
25484131 2015 Killer cell immunoglobulin receptor profile on CD4(+)  CD28(-) T cells and their pathogenic role in non-dialysis-dependent and dialysis-dependent chronic kidney disease patients.
25359276 2015 Peptide selectivity discriminates NK cells from KIR2DL2- and KIR2DL3-positive individuals.
25329633 2014 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
More...