Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.38
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Melanoma 711 3.951 2.0

Gene RIF (10)

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS      1 - 70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLLKYRAREPVTKAEMLGSVV     71 - 140
GNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTGFLIIILAIIA    141 - 210
KEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE    211 - 280
TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE                                        281 - 314
//

Text Mined References (25)

PMID Year Title