Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 5
Funding $313,502.15
PubMed Score 13.98
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Melanoma 261 3.821 1.9

Gene RIF (8)

PMID Text
25679763 Study describes a widespread mechanism to suppress AMPK through its ubiquitination and degradation by the cancer-specific MAGE-A3/6-TRIM28 ubiquitin ligase. MAGE-A3 and MAGE-A6 are highly similar proteins normally expressed only in the male germline but frequently re-activated in human cancers.
25564441 MAGEA3/6 positivity was associated with significantly better disease-free survival.
22707303 To identify novel CTL epitopes from MAGE-A6 and MAGE-A12 antigens.
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
18976975 Knockdown of melanoma antigen family A, 6 (MAGEA6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
12631591 MAGE-6 encodes HLA-DRbeta1*0401-presented epitopes recognized by CD4+ T cells from patients with melanoma or renal cell carcinoma
12208877 Disease-associated bias in T helper type 1 (Th1)/Th2 CD4(+) T cell responses against MAGE-6 in HLA-DRB10401(+) patients with renal cell carcinoma or melanoma.

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS      1 - 70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLLKYRAREPVTKAEMLGSVV     71 - 140
GNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTGFLIIILAIIA    141 - 210
KEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE    211 - 280
TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE                                        281 - 314
//

Text Mined References (21)

PMID Year Title
25679763 2015 Degradation of AMPK by a cancer-specific ubiquitin ligase.
25564441 2015 A Comprehensive Expression Analysis of Cancer Testis Antigens in Head and Neck Squamous Cell Carcinoma Revels MAGEA3/6 as a Marker for Recurrence.
25416956 2014 A proteome-scale map of the human interactome network.
22707303 2012 Identification of novel MAGE-A6- and MAGE-A12-derived HLA-A24-restricted cytotoxic T lymphocyte epitopes using an in silico peptide-docking assay.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20598277 2010 Terminal osseous dysplasia is caused by a single recurrent mutation in the FLNA gene.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...