Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P43359 Q32MD0
Symbols CT1.5
MAGE5
MAGEA4

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASA      1 - 70
IPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY                     71 - 124
//

Text Mined References (9)

PMID Year Title