Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P43359 Q32MD0
Symbols CT1.5
MAGE5
MAGEA4

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma

AA Sequence

MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASA      1 - 70
IPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY                     71 - 124
//

Text Mined References (8)

PMID Year Title
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10521804 1999 Quantitative evaluation of the expression of MAGE genes in tumors by limiting dilution of cDNA libraries.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.