Property Summary

NCBI Gene PubMed Count 17
PubMed Score 38.45
PubTator Score 25.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 8.7e-03
glioblastoma 1.100 3.9e-03
group 3 medulloblastoma 1.400 4.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 6.5e-03
lung cancer 1.100 6.2e-04
ovarian cancer -1.500 1.3e-05

Gene RIF (2)

AA Sequence

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFG      1 - 70
IVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFD     71 - 140
RRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN                               141 - 183
//

Text Mined References (19)

PMID Year Title