Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $302,313.5
PubMed Score 37.45
PubTator Score 25.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.500 0.000
glioblastoma 1.100 0.004
intraductal papillary-mucinous neoplasm ... -1.100 0.006
lung cancer 1.100 0.001
diabetes mellitus -1.200 0.009
ovarian cancer -1.500 0.000

Synonym

Accession P43308 B2R9K9 D3DVA7 Q53HI0 Q5VY95 Q5VY96 Q6IB31 Q9BWE4 TRAP-beta
Symbols TLAP
HSD25
TRAPB
TRAP-BETA

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFG      1 - 70
IVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFD     71 - 140
RRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN                               141 - 183
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18724357 2008 STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling.
18293417 2008 Epigenetic modifications of SOX2 enhancers, SRR1 and SRR2, correlate with in vitro neural differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
More...