Property Summary

NCBI Gene PubMed Count 46
PubMed Score 39.40
PubTator Score 442.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.4
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 8.8e-07
gastric carcinoma -1.300 4.0e-02
lung cancer 1.700 4.2e-02
malignant mesothelioma 1.500 2.7e-05
medulloblastoma, large-cell 1.400 1.5e-04
osteosarcoma -1.176 1.6e-04
ovarian cancer -1.300 2.4e-08
pancreatic ductal adenocarcinoma liver m... -1.312 2.8e-03
pituitary cancer 1.400 2.8e-07

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILS      1 - 70
LNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRW     71 - 140
NPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRY    141 - 210
RKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLA    211 - 280
AIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENA    281 - 350
TGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN    351 - 420
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNF    421 - 490
STSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD                     491 - 543
//

Text Mined References (48)

PMID Year Title