Property Summary

NCBI Gene PubMed Count 156
PubMed Score 602.10
PubTator Score 408.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.717 2.4
Vascular disease 319 3.554 1.8

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.059 4.9e-06
Astrocytoma, Pilocytic 1.100 2.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.219 1.5e-03
Breast cancer -1.400 1.9e-07
breast carcinoma -1.900 5.4e-04
cystic fibrosis -1.040 2.6e-04
cystic fibrosis and chronic rhinosinusit... 1.144 3.2e-02
dermatomyositis 1.500 7.1e-03
diabetes mellitus -1.100 3.6e-02
ductal carcinoma in situ -1.800 7.1e-04
fibroadenoma -1.900 2.5e-02
gastric carcinoma 1.500 1.2e-02
glioblastoma 1.700 9.5e-05
group 4 medulloblastoma -1.300 3.3e-03
interstitial cystitis 1.100 4.9e-03
intraductal papillary-mucinous adenoma (... -1.300 1.2e-04
intraductal papillary-mucinous carcinoma... -1.400 6.0e-05
intraductal papillary-mucinous neoplasm ... -1.200 4.0e-04
invasive ductal carcinoma -1.900 4.6e-03
juvenile dermatomyositis 1.317 1.5e-11
lung adenocarcinoma -1.092 1.4e-05
non primary Sjogren syndrome sicca 1.100 2.5e-02
osteosarcoma 1.886 4.8e-02
ovarian cancer 1.100 5.2e-08
pancreatic cancer 1.100 2.5e-03
pediatric high grade glioma 1.200 2.2e-03
psoriasis -1.100 3.6e-03
tuberculosis -1.200 2.6e-05
ulcerative colitis 1.200 5.1e-04
urothelial carcinoma 1.800 6.8e-04

Protein-protein Interaction (4)

Gene RIF (127)

AA Sequence

MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR      1 - 70
TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN     71 - 140
IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA    141 - 210
QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP    211 - 280
HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP    281 - 350
AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT    351 - 420
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP    421 - 490
ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV    491 - 560
VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD    561 - 630
KRAPGDQGEKYIDLRH                                                          631 - 646
//

Text Mined References (160)

PMID Year Title