Property Summary

NCBI Gene PubMed Count 133
Grant Count 65
R01 Count 18
Funding $12,015,221.57
PubMed Score 555.86
PubTator Score 408.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43121 O95812 Q59E86 Q6PHR3 Q6ZTR2
Symbols CD146
MUC18

Gene

Gene RIF (105)

PMID Text
26941359 CD146 is a novel and useful marker for predicting senescence in human umbilical cord blood-derived Mesenchymal stem cells (hUCB-MSCs), and CD146 can potentially be applied in quality-control assessments of hUCB-MSC-based therapy.
26928402 Results showed that CD146 promoted metastasis of hepatocellular carcinoma (HCC) cells and predicted poor prognosis of HCC patients. CD146 induced epithelial mesenchymal transition through probably IL-8 up-regulation and STAT1 down-regulation.
26906545 Results showed that increased human METCAM/MUC18 expression in ovarian cancer SK-OV-3 cells suppressed tumorigenesis and ascites formation in nude mice, suggesting that human METCAM/MUC18 plays a suppressor role in the progression of ovarian cancer, perhaps by reducing proliferation and angiogenesis.
26753846 CD146 dexpression efines a subpopulation of human mesenchymal stem cells capable of bone formation and in vivo trans-endothelial migration.
26617818 MUC18 is an independent prognostic factor for clear cell renal cell carcinoma
26517673 Data indicate that CD146 antigen is an effective cell surface marker for enriching tumor-propagating cells (TPCs) in primary sarcomas.
26293576 CD146, P53, and Ki-67 are overexpressed in uterine sarcoma
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1
25997612 The expression of CD146 and HIF1a was positively correlated with EGFR and CD31, respectively in salivary gland adenoid cystic carcinoma.
25995384 ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM
More...

AA Sequence

MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR      1 - 70
TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN     71 - 140
IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA    141 - 210
QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP    211 - 280
HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP    281 - 350
AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT    351 - 420
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP    421 - 490
ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV    491 - 560
VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD    561 - 630
KRAPGDQGEKYIDLRH                                                          631 - 646
//

Text Mined References (137)

PMID Year Title
26941359 2016 Downregulation of Melanoma Cell Adhesion Molecule (MCAM/CD146) Accelerates Cellular Senescence in Human Umbilical Cord Blood-Derived Mesenchymal Stem Cells.
26928402 2016 CD146 promotes metastasis and predicts poor prognosis of hepatocellular carcinoma.
26906545 2016 METCAM/MUC18 is a novel tumor and metastasis suppressor for the human ovarian cancer SKOV3 cells.
26753846 2016 CD146/MCAM defines functionality of human bone marrow stromal stem cell populations.
26617818 2015 Decreased expression of mucin 18 is associated with unfavorable postoperative prognosis in patients with clear cell renal cell carcinoma.
26517673 2015 Identification of CD146 as a marker enriched for tumor-propagating capacity reveals targetable pathways in primary human sarcoma.
26293576 2015 CD146 as an adverse prognostic factor in uterine sarcoma.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25997612 2015 Role of hypoxia-inducible factor-1? and CD146 in epidermal growth factor receptor-mediated angiogenesis in salivary gland adenoid cystic carcinoma.
25995384 2015 ZBTB7A Suppresses Melanoma Metastasis by Transcriptionally Repressing MCAM.
More...