Property Summary

NCBI Gene PubMed Count 3,271
PubMed Score 5032.17
PubTator Score 5901.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Hyperhomocysteinemia 37 7.743 3.9
Thrombophilia 38 6.385 3.2
Cleft Lip 141 4.489 2.2
Down syndrome 499 4.33 2.2
Pulmonary embolism 55 4.283 2.1
Schizophrenia 1160 4.001 2.0
Mucositis 29 3.791 1.9
Acute kidney injury 70 0.0 0.0
Alopecia 115 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Anemia 365 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Bipolar Disorder 666 0.0 0.0
Blood Coagulation Disorders, Inherited 1 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Cervical Intraepithelial Neoplasia 2 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Clubfoot 39 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Coronary Disease 25 0.0 0.0
Coronary Restenosis 8 0.0 0.0
Crohn Disease 45 0.0 0.0
Depressive disorder 409 0.0 0.0
Diabetic Angiopathies 16 0.0 0.0
Drug Eruptions 18 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 62 0.0 0.0
Endometrial Neoplasms 55 0.0 0.0
Gastrointestinal Diseases 12 0.0 0.0
Graft vs Host Disease 6 0.0 0.0
Hearing Loss, Sudden 1 0.0 0.0
Heart Defects, Congenital 37 0.0 0.0
Hematologic Diseases 8 0.0 0.0
Hypersensitivity 63 0.0 0.0
Infertility, Female 28 0.0 0.0
Infertility, Male 46 0.0 0.0
Kidney Diseases 114 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Leukoencephalopathies 29 0.0 0.0
Leukopenia 72 0.0 0.0
Liver diseases 87 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lymphoma 81 0.0 0.0
Lymphoma, Follicular 18 0.0 0.0
Lymphoma, Non-Hodgkin 24 0.0 0.0
Malnutrition 11 0.0 0.0
Maxillofacial Abnormalities 1 0.0 0.0
Meningomyelocele 6 0.0 0.0
Methylenetetrahydrofolate reductase deficiency 1 0.0 0.0
Microsatellite Instability 12 0.0 0.0
Microvascular Angina 1 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Neural tube defect, folate-sensitive 4 0.0 0.0
Neutropenia 72 0.0 0.0
Precursor Cell Lymphoblastic Leukemia-Lymphoma 49 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Sinus Thrombosis, Intracranial 2 0.0 0.0
Skin Diseases 71 0.0 0.0
Spinal Cord Diseases 3 0.0 0.0
Spinal Dysraphism 12 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Thrombocytopenia 197 0.0 0.0
Thyrotoxicosis 38 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Uterine Cervical Neoplasms 26 0.0 0.0
Vascular Diseases 16 0.0 0.0
Venous Thrombosis 47 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
spina bifida 1074 4.854 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 2.6e-02
non-small cell lung cancer -1.037 1.3e-11
osteosarcoma 2.233 4.2e-06
ovarian cancer -1.100 2.8e-06

 GO Component (2)

Gene RIF (4028)

AA Sequence

MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWFSLEFFPPRTA      1 - 70
EGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCRQRLEEITG     71 - 140
HLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKGHPEAGSFEAD    141 - 210
LKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEI    211 - 280
KDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWA    281 - 350
LSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM    351 - 420
WGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNING    421 - 490
KPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVT    491 - 560
WGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDFPLDN    561 - 630
CLWQVVEDTLELLNRPTQNARETEAP                                                631 - 656
//

Text Mined References (3279)

PMID Year Title