Property Summary

NCBI Gene PubMed Count 71
PubMed Score 112.66
PubTator Score 89.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 2.800 2.1e-05
astrocytoma 1.200 5.9e-06
Astrocytoma, Pilocytic 2.500 8.2e-08
Breast cancer 1.700 9.5e-06
breast carcinoma -1.700 1.0e-03
ductal carcinoma in situ -2.300 2.6e-04
ependymoma 1.300 2.0e-03
fibroadenoma -2.100 2.9e-02
glioblastoma 2.500 3.5e-09
group 3 medulloblastoma 2.200 1.0e-03
intraductal papillary-mucinous adenoma (... -1.300 7.6e-04
invasive ductal carcinoma -2.800 3.6e-04
oligodendroglioma 1.200 9.5e-05
osteosarcoma 1.664 1.3e-04
ovarian cancer -1.200 4.9e-02
pituitary cancer -1.100 2.3e-04
psoriasis 1.600 2.1e-04

Synonym

Accession P42773 Q8TB83
Symbols p18
INK4C
p18-INK4C

Gene

PDB

1BU9   1G3N   1IHB   1MX2   1MX4   1MX6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (46)

AA Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTG      1 - 70
FAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA     71 - 140
CDLARLYGRNEVVSLMQANGAGGATNLQ                                              141 - 168
//

Text Mined References (72)

PMID Year Title