Property Summary

NCBI Gene PubMed Count 66
Grant Count 142
R01 Count 72
Funding $11,130,677.6
PubMed Score 109.01
PubTator Score 89.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.600 0.000
astrocytoma 1.200 0.000
glioblastoma 2.500 0.000
oligodendroglioma 1.200 0.000
osteosarcoma 1.664 0.000
ependymoma 1.300 0.002
sonic hedgehog group medulloblastoma 2.400 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.001
breast carcinoma -1.700 0.001
fibroadenoma -2.100 0.029
adult high grade glioma 2.800 0.000
pilocytic astrocytoma 2.500 0.000
ductal carcinoma in situ -2.300 0.000
invasive ductal carcinoma -2.800 0.000
ovarian cancer -1.200 0.049
Breast cancer 1.700 0.000
pituitary cancer -1.100 0.000

Synonym

Accession P42773 Q8TB83
Symbols p18
INK4C
p18-INK4C

Gene

PDB

1BU9   1G3N   1IHB   1MX2   1MX4   1MX6  

Gene RIF (42)

PMID Text
26740620 Data suggest that cell cycle-dependent kinase inhibitors CDKN2C/p18 and CDKN1A/p21 facilitate cell cycle entry/cell proliferation of quiescent adult human pancreatic beta cells in primary culture (from tissues obtained from organ donors).
26350239 DNA methyltransferase 3A promotes cell proliferation by silencing CDK inhibitor p18INK4C in gastric carcinogenesis
24127162 Mutations in CDKN2C is associated with sporadic parathyroid adenoma.
23896637 this studydemonstrated abundant levels of the critical negative cell-cycle regulators, p27(Kip1), its phosphorylated form, p-p27(S10), p18Ink4c, and GSK-3, in beta-cells of both adult human and mouse pancreatic islets, which contribute to maintenance of beta-cell quiescence.
23715670 in 85 sporadic parathyroid adenomas, study identified alterations in 5 adenomas: 2 contained heterozygous changes in CDKN1A, 1 germline and 1 of undetermined germline status; 1 had a CDKN2B germline alteration, accompanied by loss of the normal allele in the tumor (LOH); 2 had variants of CDKN2C, 1 somatic and 1 germline with LOH
22896639 Analysis of B1a lymphocyte phenotypes of p18-deficient C57BL/6 mice finds that p18 is a key regulator of the size of the B1a cell pool.
22685290 up-regulated HULC promotes proliferation of hepatoma cells through suppressing p18
22080569 propose that the contrasting behavior of the two very similar INK4 proteins could reflect their respective roles in senescence versus differentiation
21994415 Data indicate that the role of CDKN2C in the adverse outcome of cases with hemizygous deletion was less certain.
21112821 results demonstrate for the first time that N-Myc is a downstream target of RET2A signaling, and propose that induction of N-Myc by RET2A is a key step leading to lower p18 levels during MEN2A tumorigenesis
More...

AA Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTG      1 - 70
FAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA     71 - 140
CDLARLYGRNEVVSLMQANGAGGATNLQ                                              141 - 168
//

Text Mined References (67)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26740620 2016 High-throughput Functional Genomics Identifies Regulators of Primary Human Beta Cell Proliferation.
26350239 2015 DNA methyltransferase 3A promotes cell proliferation by silencing CDK inhibitor p18INK4C in gastric carcinogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
24127162 2013 Mutations in CDKN2C (p18) and CDKN2D (p19) may cause sporadic parathyroid adenoma.
23896637 The negative cell cycle regulators, p27(Kip1), p18(Ink4c), and GSK-3, play critical role in maintaining quiescence of adult human pancreatic ?-cells and restrict their ability to proliferate.
23715670 2013 Germline and somatic mutations in cyclin-dependent kinase inhibitor genes CDKN1A, CDKN2B, and CDKN2C in sporadic parathyroid adenomas.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22896639 2012 Cyclin-dependent kinase inhibitor Cdkn2c deficiency promotes B1a cell expansion and autoimmunity in a mouse model of lupus.
More...