Property Summary

NCBI Gene PubMed Count 30
PubMed Score 0.86
PubTator Score 170.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.070 3.8e-02
active ulcerative colitis 1.443 4.6e-03
adult high grade glioma 1.600 2.6e-03
aldosterone-producing adenoma -1.353 1.8e-02
astrocytoma 1.800 4.8e-02
Astrocytoma, Pilocytic 2.200 5.1e-07
atypical teratoid / rhabdoid tumor 1.200 1.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.587 8.5e-03
Chronic Lymphocytic Leukemia -1.043 1.1e-03
cystic fibrosis 1.145 3.2e-05
dermatomyositis 1.400 1.0e-02
Duchenne muscular dystrophy 1.745 2.2e-06
ependymoma 1.300 2.7e-03
gastric carcinoma 1.300 3.5e-02
glioblastoma 1.800 1.4e-05
interstitial cystitis 1.100 3.9e-03
juvenile dermatomyositis 1.476 1.4e-07
lung cancer -2.600 1.5e-05
medulloblastoma 1.100 3.5e-03
medulloblastoma, large-cell 1.100 6.0e-05
nasopharyngeal carcinoma -1.100 5.0e-03
osteosarcoma 1.378 3.3e-04
ovarian cancer -1.100 2.6e-02
pancreatic cancer 1.300 4.9e-04
primary pancreatic ductal adenocarcinoma 1.424 3.4e-03
primary Sjogren syndrome 1.200 3.0e-04
psoriasis 2.000 6.3e-04

 IMPC Phenotype (1)

Gene RIF (11)

AA Sequence

MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKN      1 - 70
IIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHS     71 - 140
GLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVSLPSTSEAAAA    141 - 210
SAFLASSVSAKISSLMLPNAASISSASPFSSRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGS    211 - 280
KTKSPSLPPKAKKPKGLEISAPPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSI    281 - 350
HFWSSLSPVAPLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS                 351 - 407
//

Text Mined References (34)

PMID Year Title