Property Summary

NCBI Gene PubMed Count 25
Grant Count 85
R01 Count 48
Funding $7,895,949.22
PubMed Score 0.86
PubTator Score 170.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P41970 B2R6S6 Q6FG57 Q6GU29 Q9UD17
Symbols ERP
NET
SAP2
SAP-2

Gene

PANTHER Protein Class (1)

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (7)

PMID Text
26637400 results suggest that ELK3 plays a positive role in the metastasis of BC cells by indirectly regulating MT1-MMP expression
25401928 The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response.
24719561 ELK3 plays a negative role of VEGF-induced angiogenesis through indirectly inhibiting ETS-1 function.
20427288 Net and HIF1alpha are components of distinct signaling pathways that are intricately linked
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18832796 These findings suggested that loss of Net repression could augment c-fos expression and further trigger neoplastic cell proliferation, which was involved in the pathogenesis of pancreatic cancer.
18316589 the Ras-Net (Elk-3) pathway involves microtubules and is inhibited by pyrazoles

AA Sequence

MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKN      1 - 70
IIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHS     71 - 140
GLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVSLPSTSEAAAA    141 - 210
SAFLASSVSAKISSLMLPNAASISSASPFSSRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGS    211 - 280
KTKSPSLPPKAKKPKGLEISAPPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSI    281 - 350
HFWSSLSPVAPLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS                 351 - 407
//

Text Mined References (28)

PMID Year Title
26637400 2015 ELK3 Expression Correlates With Cell Migration, Invasion, and Membrane Type 1-Matrix Metalloproteinase Expression in MDA-MB-231 Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25401928 2014 The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response.
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24719561 2014 ELK3 suppresses angiogenesis by inhibiting the transcriptional activity of ETS-1 on MT1-MMP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20427288 2010 Involvement of net and Hif1alpha in distinct yet intricately linked hypoxia-induced signaling pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18832796 2008 Growth inhibitory effect of the ternary complex factor Net on human pancreatic carcinoma cell lines.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...