Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.26
PubTator Score 9.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 1.215 2.3e-05
malignant mesothelioma -3.800 3.7e-08
non-small cell lung cancer -1.056 1.3e-13
osteosarcoma -4.523 1.7e-05
tuberculosis 2.200 1.1e-02

 GO Function (1)

Gene RIF (5)

AA Sequence

MAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQ      1 - 70
ELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERW     71 - 140
WEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQM    141 - 210
WFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS                                         211 - 243
//

Text Mined References (14)

PMID Year Title