Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.68
PubTator Score 9.13

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.30147001267545E-13
malignant mesothelioma 3163 3.67755324173706E-8
osteosarcoma 7933 1.74026019036801E-5
cystic fibrosis 1670 2.32921636552617E-5
tuberculosis 1563 0.011138814134437


  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -3.800 0.000
osteosarcoma -4.523 0.000
cystic fibrosis 1.215 0.000
tuberculosis 2.200 0.011
non-small cell lung cancer -1.056 0.000


Accession P41439 J3KQ90 Q05C14 FR-gamma
Symbols FR-G


  Ortholog (4)

Species Source
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

20683905 The rare alleles of specific single nucleotide polymorphisms within the FOLR1, FOLR2, and FOLR3 genes were statistically significant for association with meningomyelocele.
20683905 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

WFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS                                         211 - 243

Text Mined References (14)

PMID Year Title
24732178 2014 Pharmacogenetics of pemetrexed combination therapy in lung cancer: pathway analysis reveals novel toxicity associations.
24485798 2014 Gene expression signatures of primary and metastatic uterine leiomyosarcoma.
24184359 2014 Purifying selection against gene conversions in the folate receptor genes of primates.
20683905 2010 Association of folate receptor (FOLR1, FOLR2, FOLR3) and reduced folate carrier (SLC19A1) genes with meningomyelocele.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.