Property Summary

NCBI Gene PubMed Count 45
PubMed Score 175.38
PubTator Score 109.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.834 1.9
Disease Target Count Z-score Confidence
Hypopituitarism 40 5.689 2.8
Holoprosencephaly 56 4.026 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 2.7e-03
Astrocytoma, Pilocytic 1.400 7.6e-04
glioblastoma 1.700 2.3e-02
oligodendroglioma 1.100 3.5e-08
pediatric high grade glioma 1.700 2.9e-03
primitive neuroectodermal tumor 2.600 8.5e-03
psoriasis -1.200 2.5e-03

Gene RIF (33)

AA Sequence

MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHL      1 - 70
LPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSANAAGGANSGGGSSGGASGGGGGTDQDRVK     71 - 140
RPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRP    141 - 210
RRKTKTLLKKDKYSLPSGLLPPGAAAAAAAAAAAAAAASSPVGVGQRLDTYTHVNGWANGAYSLVQEQLG    211 - 280
YAQPPSMSSPPPPPALPPMHRYDMAGLQYSPMMPPGAQSYMNVAAAAAAASGYGGMAPSATAAAAAAYGQ    281 - 350
QPATAAAAAAAAAAMSLGPMGSVVKSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPG    351 - 420
GRLHGVHQHYQGAGTAVNGTVPLTHI                                                421 - 446
//

Text Mined References (46)

PMID Year Title