Property Summary

NCBI Gene PubMed Count 8
Grant Count 20
R01 Count 16
Funding $903,284.42
PubMed Score 7.00
PubTator Score 56.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.003 0.006
glioblastoma 1.500 0.001
ovarian cancer 2.300 0.000

Gene RIF (2)

PMID Text
25731616 High BUD31 expression is associated with hepatocellular carcinoma.
22944692 Positional proteomics analysis identifies the cleavage of human BUD31 homolog (S. cerevisiae) (BUD31) at amino acid residues 17-18 by the HIV-1 protease

AA Sequence

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAI      1 - 70
SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR     71 - 140
GCSG                                                                      141 - 144
//

Text Mined References (11)

PMID Year Title
25731616 2015 Meta-analysis of gene expression profiles indicates genes in spliceosome pathway are up-regulated in hepatocellular carcinoma (HCC).
25416956 2014 A proteome-scale map of the human interactome network.
25091737 2014 Identification of a new androgen receptor (AR) co-regulator BUD31 and related peptides to suppress wild-type and mutated AR-mediated prostate cancer growth via peptide screening and X-ray structure analysis.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...