Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.98
PubTator Score 56.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.2e-05
glioblastoma 5792 7.6e-04
Multiple myeloma 1332 5.9e-03

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.500 7.6e-04
Multiple myeloma 1.003 5.9e-03
ovarian cancer 2.300 2.2e-05

Synonym

Accession P41223 A4D274 B7Z4S9 D6W5S6 Q6IB53 Q9UDV1
Symbols G10
EDG2
Cwc14
EDG-2
fSAP17
YCR063W

Gene

PDB

5XJC   5MQF   4OED   4OH6   4OKB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAI      1 - 70
SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR     71 - 140
GCSG                                                                      141 - 144
//

Text Mined References (11)

PMID Year Title